Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MRRFILERNPTNVKNMAKLSPIPHTLLGIRKFMLERNHTSVINVAQPLFYPQPLVNMRRFILERNSTNVK      1 - 70
NVAKPSTIFHTLLYIRQFILERNAINGIKTFTWSSSPHKHRRTHTGEKPYKCEECGKAFTASSTLSEYKT     71 - 140
IHTGEKPCKCEECGKAFNWSSDFNKHKRIHSGQKPIL                                     141 - 177
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.