Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MRRFILERNPTNVKNMAKLSPIPHTLLGIRKFMLERNHTSVINVAQPLFYPQPLVNMRRFILERNSTNVK      1 - 70
NVAKPSTIFHTLLYIRQFILERNAINGIKTFTWSSSPHKHRRTHTGEKPYKCEECGKAFTASSTLSEYKT     71 - 140
IHTGEKPCKCEECGKAFNWSSDFNKHKRIHSGQKPIL                                     141 - 177
//

Text Mined References (6)

PMID Year Title