Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.82112737871762E-7
group 3 medulloblastoma 2254 9.45889313386753E-6
pituitary cancer 1972 1.69534096448738E-5
lung adenocarcinoma 2714 7.75328725905461E-5
glioblastoma 5572 2.10168232308395E-4
atypical teratoid/rhabdoid tumor 1095 3.72877066215368E-4
osteosarcoma 7933 5.96882400051583E-4
pediatric high grade glioma 2712 6.37588978344543E-4
medulloblastoma, large-cell 6234 8.03851581733765E-4
primitive neuroectodermal tumor 3031 0.00116401183611798

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.205 0.001
posterior fossa group B ependymoma -1.400 0.000
glioblastoma -1.200 0.000
group 3 medulloblastoma -2.500 0.000
medulloblastoma, large-cell -1.400 0.001
primitive neuroectodermal tumor -1.500 0.001
pediatric high grade glioma -1.300 0.001
atypical teratoid/rhabdoid tumor -1.100 0.000
lung adenocarcinoma 1.100 0.000
pituitary cancer 1.600 0.000

Gene RIF (1)

PMID Text
21461611 expression of FAM43B, regulated by methylation and epigenetic silencing could contribute to hepatocellular carcinoma tumorigenesis by regulating cell proliferation

AA Sequence

MLPWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDP      1 - 70
TYTVWYLGNAVTLHAKGDGCTDDAVGKIWARCGPGGGTKMKLTLGPHGIRMQPCERSAAGGSGGRRPAHA     71 - 140
YLLPRITYCTADGRHPRVFAWVYRHQARHKAVVLRCHAVLLARAHKARALARLLRQTALAAFSDFKRLQR    141 - 210
QSDARHVRQQHLRAGGAAASVPRAPLRRLLNAKCAYRPPPSERSRGAPRLSSIQEEDEEEEEDDAEEQEG    211 - 280
GVPQRERPEVLSLARELRTCSLRGAPAPPPPAQPRRWKAGPRERAGQAR                         281 - 329
//

Text Mined References (5)

PMID Year Title
21461611 2011 Expression of a novel gene FAM43B repressing cell proliferation is regulated by DNA methylation in hepatocellular carcinoma cell lines.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.