Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

AA Sequence

MPYTDVVIHEIQRLVDIVPMGVPHNIIQDTQFRGYLLPKGTDVFPLLGSVLKDPKYFRYPDAFYPQHFLD      1 - 70
EQGRFKKNEAFVPFSSGKRICLGEAMARMELFLYFTSTLQNFSLCSLVPLVDIDITPKLSGFGNITPTYE     71 - 140
LCLVAR                                                                    141 - 146
//

Text Mined References (5)

PMID Year Title
18085818 2007 Comparative genomics search for losses of long-established genes on the human lineage.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11186129 2000 Characterization of human CYP2G genes: widespread loss-of-function mutations and genetic polymorphism.
8561797 1996 Identification of human genes related to olfactory-specific CYP2G1.