Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma multiforme 347 5.7306005779278E-27
astrocytoma 1493 5.16818152869305E-24
oligodendroglioma 2849 2.44035603457661E-16
posterior fossa group A ependymoma 1511 6.56294766251306E-8
pilocytic astrocytoma 3086 8.35175686336012E-7
ovarian cancer 8492 1.20293582818428E-5
osteosarcoma 7933 3.466710010747E-4
adult high grade glioma 2148 0.00186608880191421
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0035826337321759
primitive neuroectodermal tumor 3031 0.0139069620979555
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0216515340758431

Expression

Synonym

Accession Q6ZSS3 Q14DC7 Q8TE91
Symbols

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

AA Sequence

MLQTTWPQESVTFEDVAVYFTQNQWASLDPAQRALYGEVMLENYANVASLVAFPFPKPALISHLERGEAP      1 - 70
WGPDPWDTEILRGISQGGESWIKNEGLVIKQEASEETELHRMPVGGLLRNVSQHFDFKRKALKQTFNLNP     71 - 140
NLILRGGMKFYECKECGKIFRYNSKLIRHQMSHTGEKPFKCKECGKAFKSSYDCIVHEKNHIGEGPYECK    141 - 210
ECGKGLSSNTALTQHQRIHTGEKPYECKECGKAFRRSAAYLQHQRLHTGEKLYKCKECWKAFGCRSLFIV    211 - 280
HQRIHTGEKPYQCKECGKAFTQKIASIQHQRVHTGEKPYECKVCGKAFKWYGSFVQHQKLHPVEKKPVKV    281 - 350
LGPSLVSPQCSSPAIPPVLLQGSCSASAVAVPSLTFPHAVLIPTSGNFFMLLPTSGIPSSSAQIVRVFQG    351 - 420
LTPTVKPSPVILTPSSHSS                                                       421 - 439
//

Text Mined References (5)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.