Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.100 1.9e-03
astrocytoma 1.400 5.2e-24
Astrocytoma, Pilocytic 1.600 9.1e-07
ependymoma 1.100 2.7e-06
glioblastoma 1.400 9.7e-07
intraductal papillary-mucinous adenoma (... 1.100 9.0e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.2e-02
oligodendroglioma 1.200 2.4e-16
osteosarcoma -1.536 3.5e-04
ovarian cancer -1.100 1.2e-05
primitive neuroectodermal tumor 1.100 1.4e-02

AA Sequence

MLQTTWPQESVTFEDVAVYFTQNQWASLDPAQRALYGEVMLENYANVASLVAFPFPKPALISHLERGEAP      1 - 70
WGPDPWDTEILRGISQGGESWIKNEGLVIKQEASEETELHRMPVGGLLRNVSQHFDFKRKALKQTFNLNP     71 - 140
NLILRGGMKFYECKECGKIFRYNSKLIRHQMSHTGEKPFKCKECGKAFKSSYDCIVHEKNHIGEGPYECK    141 - 210
ECGKGLSSNTALTQHQRIHTGEKPYECKECGKAFRRSAAYLQHQRLHTGEKLYKCKECWKAFGCRSLFIV    211 - 280
HQRIHTGEKPYQCKECGKAFTQKIASIQHQRVHTGEKPYECKVCGKAFKWYGSFVQHQKLHPVEKKPVKV    281 - 350
LGPSLVSPQCSSPAIPPVLLQGSCSASAVAVPSLTFPHAVLIPTSGNFFMLLPTSGIPSSSAQIVRVFQG    351 - 420
LTPTVKPSPVILTPSSHSS                                                       421 - 439
//

Text Mined References (5)

PMID Year Title