Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.65
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.304 0.001
ependymoma 2.300 0.000
glioblastoma 1.800 0.000
juvenile dermatomyositis 1.148 0.000
pediatric high grade glioma 2.000 0.000
pilocytic astrocytoma 1.900 0.000
invasive ductal carcinoma -1.200 0.013
ovarian cancer -2.000 0.000
Breast cancer -1.100 0.000
pituitary cancer 1.100 0.014

Synonym

Accession Q6ZSC3 B2RMT5
Symbols C2orf38

Gene

 Compartment GO Term (1)

AA Sequence

MASVLNVKESKAPERTVVVAGLPVDLFSDQLLAVLVKSHFQDIKNEGGDVEDVIYPTRTKGVAYVIFKEK      1 - 70
KVAENVIRQKKHWLARKTRHAELTVSLRVSHFGDKIFSSVNAILDLSVFGKEVTLETLVKDLKKKIPSLS     71 - 140
FSPLKPNGRISVEGSFLAVKRLRESLLARACSLLEKDRNFTSEERKWNRQNPQRNLQRSNNSLASVRTLV    141 - 210
PETARSGEMLVLDTDVFLYLKHKCGSYESTLKKFHILSQEKVDGEITTICLKSIQVGSQPNNAKHVKELI    211 - 280
EEWSHALYLKLRKETFILEGKENREKRMIKRACEQLSSRYLEVLINLYRTHIDIIGSSSDTYLFKKGVMK    281 - 350
LIGQKVS                                                                   351 - 357
//

Text Mined References (6)

PMID Year Title
23472165 2013 Genome-wide association study link novel loci to endometriosis.
22238593 2012 A genome-wide association search for type 2 diabetes genes in African Americans.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.