Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZS92
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MCMNTSIHAHTYARTHTHSVFMSSNVTVFQWMRLMRASSRSFTQAIPAGQLLQTACSHLFTTQNTCQNAL      1 - 70
GNNTRLQHTEKVRLSIGLADFGLPGIARNTFVVPDSISRYCREGSVIGKCCPSRKSALLNKQGSLKKFKI     71 - 140
TRGETQPGVTISVLELAEIDQRF                                                   141 - 163
//

Text Mined References (2)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.