Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZS46
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MQTCSGKGIKMAFLDVQSSSTPQSLPLLLFSHREGGGRGAGDPGAPAVVPAPVSAPRPASSPARSESRSP      1 - 70
PLTLISRHITCCSCESPGDVLLSGRGGGGGGGGGARTGGGEGEDRRPRPDFSRVTAVAIPGWMEVESPPH     71 - 140
PPPQPQVCPTPSQGAPGHGRAGLPEGKGPGGRDWLRSQSSRCSRATLFGHRAPSPAAPRRGRLPAPGFPS    141 - 210
LHSAVSLF                                                                  211 - 218
//

Text Mined References (2)

PMID Year Title