Property Summary

NCBI Gene PubMed Count 5
Grant Count 5
R01 Count 5
Funding $219,304.64
PubMed Score 4.71
PubTator Score 0.78

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
22291991 RINL, as a GEF for Rab5 subfamily, is implicated in the EphA8-degradation pathway via its interaction with odin.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAQPEDKAPEVPTEGVRLVPPQVNKADRTPLGVLSTLEPLTRLQRTWGVWHVPELDTQDAEALVGLWPLG      1 - 70
SFLVTGRDPSQALVLRSGPLPGEVNTYQIQKIPRGVSLESSNLCMPDLPHLLAFLSASRDVLPRTLLLPP     71 - 140
PTLGPRDEHTDPVQIGRVQQDTPGKVLSIVNQLYLETHRGWGREQTPQETEPEAAQRHDPAPRNPAPHGV    141 - 210
SWVKGPLSPEVDHPGPALASLLEEEEEDLEGKEEGREDDPEEEGPEDVLTIHVQSLVRARSSYVARQYRS    211 - 280
LRVRIASDSGGPHGSGDPATELLQDVRHLLTDLQDHLAKDSYIRAVFGSRGPGLPKKDEDPGPALETAVC    281 - 350
QAVLAPLKPALWTRLRTLRAPELRRLRRRQTALRAGAGPPGAQGPGPEGQSPAPALRSRIHERLAHLHAA    351 - 420
CAPRRKVALLLEVCRDVYAGLARGENQDPLGADAFLPALTEELIWSPDIGDTQLDVEFLMELLDPDELRG    421 - 490
EAGYYLTTWFGALHHIAHYQPETDRAPRGLSSEARASLHQWHRRRTLHRKDHPRAQANLPFKEPWAEETV    491 - 560
TGTSDN                                                                    561 - 566
//

Text Mined References (6)

PMID Year Title
22291991 2012 RINL, guanine nucleotide exchange factor Rab5-subfamily, is involved in the EphA8-degradation pathway with odin.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.