Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.89
PubTator Score 0.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Gene RIF (3)

PMID Text
22159412 DCDC5 colocalizes with Rab8 and links it to dynein during cytokinesis. DCDC5 knockdown increased apoptosis and the number of multinucleated cells.
20700443 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MKKPICKTTEPYAPVRLRVLQNGEKNKNRSVTILGPDISPGRKTQCTEILNLPSAARRLYNEKGKEIFAL      1 - 70
KDLQRDELVYVSCGELWINPDLSIAQQKKQIFLRNLESDIAKIQIFCSTHKIEALVLEVQSDIVSGSKLA     71 - 140
VHKPVAIFGEEKQVTEPEEKQMQEDPLTTENASSEILDSHVRAHLRMKACHTLPRYAWQETSHDFDEDDS    141 - 210
LPKKTEKGLFENVEPQKKHSCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLVE    211 - 280
KKSDGSHQRWIHQEDSRTFHLVSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNNGAANQKWHYMKNIKA    281 - 350
LVAFHSTALDKEITSANYAGVCTSSVIKEENIDQPGYCYLSPDGKRKTMLCLACGQSMRTEKGLKQLLPG    351 - 420
VPFLCISGTKTQKPFLQGPFKVISVAEVDLSCDKAEKTLSYYQARLLSLRMKTCTQAASHSGMAATHQKA    421 - 490
VKIIAYKNGDGYRNGKLIVAGTFPMLLTECTEQLGLARAASKVYTKDGTPIFTLRDLVLWALDESFLQRD    491 - 560
SEKQKQDAAPVGKEQIIVEKNPRMKVKNRLFAKSVTSDSLDGIDKSLLTLILRNPIAIWVSCGEPFLPPN    561 - 630
ESRKIRETELAKKGQNFG                                                        631 - 648
//

Text Mined References (13)

PMID Year Title
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22159412 2011 Linking cytoplasmic dynein and transport of Rab8 vesicles to the midbody during cytokinesis by the doublecortin domain-containing 5 protein.
20700443 2010 Genome-wide association studies of serum magnesium, potassium, and sodium concentrations identify six Loci influencing serum magnesium levels.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20236041 2010 The doublecortin gene family and disorders of neuronal structure.
19801982 2009 Twenty bone-mineral-density loci identified by large-scale meta-analysis of genome-wide association studies.
16869982 2006 The evolving doublecortin (DCX) superfamily.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...