Property Summary

NCBI Gene PubMed Count 12
Grant Count 5
R01 Count 5
Funding $351,491.5
PubMed Score 5.09
PubTator Score 4.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.803 0.000
medulloblastoma, large-cell 1.300 0.000
adrenocortical carcinoma 1.009 0.003

Synonym

Accession Q6ZRP7 A2CEE0 A6NLB0 Q5TB37 Q7Z7B6 Q86VV7 Q8N3G2
Symbols SOXN
QSCN6L1

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
26894260 Self-interaction of the transmembrane helix of QSOX2 rests on a motif of conserved amino acids compromising one face of the helix.
22503243 The present study was unable to confirm a significant association of all of the three SNPs, rs12338076 in LHX3-QSOX2, and rs1457595 and rs17032362 in IGF1, with adult height in our study population.
20189936 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
14633699 Results identify SOXN as a major player in Regulating the sensitization of neuroblastoma cells for IFN-gamma-induced apoptosis.

AA Sequence

MAAAGAAVARSPGIGAGPALRARRSPPPRAARLPRLLVLLAAAAVGPGAGGAARLYRAGEDAVWVLDSGS      1 - 70
VRGATANSSAAWLVQFYSSWCGHCIGYAPTWRALAGDVRDWASAIRVAALDCMEEKNQAVCHDYDIHFYP     71 - 140
TFRYFKAFTKEFTTGENFKGPDRELRTVRQTMIDFLQNHTEGSRPPACPRLDPIQPSDVLSLLDNRGSHY    141 - 210
VAIVFESNSSYLGREVILDLIPYESIVVTRALDGDKAFLEKLGVSSVPSCYLIYPNGSHGLINVVKPLRA    211 - 280
FFSSYLKSLPDVRKKSLPLPEKPHKEENSEIVVWREFDKSKLYTVDLESGLHYLLRVELAAHKSLAGAEL    281 - 350
KTLKDFVTVLAKLFPGRPPVKKLLEMLQEWLASLPLDRIPYNAVLDLVNNKMRISGIFLTNHIKWVGCQG    351 - 420
SRSELRGYPCSLWKLFHTLTVEASTHPDALVGTGFEDDPQAVLQTMRRYVHTFFGCKECGEHFEEMAKES    421 - 490
MDSVKTPDQAILWLWKKHNMVNGRLAGHLSEDPRFPKLQWPTPDLCPACHEEIKGLASWDEGHVLTFLKQ    491 - 560
HYGRDNLLDTYSADQGDSSEGGTLARGEEEEKRLTPPEVSHGDRDTQSVRPPGALGPRPALPESLHHSLD    561 - 630
GKLQSLDGPGAHKEVGGAAPFLGVDFSSLDMSLCVVLYVASSLFLMVMYFFFRVRSRRWKVKHHHPAV      631 - 698
//

Text Mined References (19)

PMID Year Title
26894260 2016 Entrapment of Water at the Transmembrane Helix-Helix Interface of Quiescin Sulfhydryl Oxidase 2.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22503243 2012 Replication study of the association of SNPs in the LHX3-QSOX2 and IGF1 loci with adult height in the Japanese population; wide-ranging comparison of each SNP genotype distribution.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...