Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZRP5
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MRIFRGCTQPSTLGQGVHSPLMKAQFITHHSRKQVKPGEGWGRSSFTRACRDHTTILSGNRSFSAVAATP      1 - 70
AKHKHMHTRTHTHMHTHTGMHTLTGTHVHTPHTQMHTRILTLSHMHTHAHTHAHTHGHTHTRAHSTHAHT     71 - 140
HAHSHYHTRTLTLTHSHAHSCTLTSTITHMHTHTHMHTHTSTLTRTLTLTHTHMHTFLSLVSHLAGYISC    141 - 210
QFIFSSENPRLCH                                                             211 - 223
//

Text Mined References (2)

PMID Year Title