Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MLRDSEAEVTEEDPRLRAQQLHHRVLTLQCQLRDQGAAHQASLDEATRLQEELQAKLEELQKKQHEAKLA      1 - 70
VTPLKAKIASLVRKCRERNRLITHLLQELHRHGLGNLLLSELAQNMLNDVALAEYTATFLAPGVPETSHH     71 - 140
LDVKSEMTAALRAQTYLLNPEMDSVLQSSLSSESWPIPEPEWPAQTAQLDSLKLPLSLVSTLDPGTCLAA    141 - 210
VTVEPGLPAQRLQEKGGMPCPALQVDNVPAPSELLSPARILAFHQELRQSICSNSQVHKSPLELEM        211 - 276
//

Text Mined References (6)

PMID Year Title