Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLRDSEAEVTEEDPRLRAQQLHHRVLTLQCQLRDQGAAHQASLDEATRLQEELQAKLEELQKKQHEAKLA      1 - 70
VTPLKAKIASLVRKCRERNRLITHLLQELHRHGLGNLLLSELAQNMLNDVALAEYTATFLAPGVPETSHH     71 - 140
LDVKSEMTAALRAQTYLLNPEMDSVLQSSLSSESWPIPEPEWPAQTAQLDSLKLPLSLVSTLDPGTCLAA    141 - 210
VTVEPGLPAQRLQEKGGMPCPALQVDNVPAPSELLSPARILAFHQELRQSICSNSQVHKSPLELEM        211 - 276
//

Text Mined References (5)

PMID Year Title
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.