Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
substance-related disorder 105 1.0

Synonym

Accession Q6ZQY7
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MISFHVIFLSLGRGKLFLPVNFCFLKLKNSQVRIPKDFTCNLHVLFRTVQGEDRNTMFRGHWSIYSRNFP      1 - 70
LAVVPAYVTEDGKNTSHRASGQFCNALSQGEIPSSLQLVNSYALEPRTDMPCNFLT                   71 - 126
//

Text Mined References (1)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.