Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 1.2

Synonym

Accession Q6ZQY7
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MISFHVIFLSLGRGKLFLPVNFCFLKLKNSQVRIPKDFTCNLHVLFRTVQGEDRNTMFRGHWSIYSRNFP      1 - 70
LAVVPAYVTEDGKNTSHRASGQFCNALSQGEIPSSLQLVNSYALEPRTDMPCNFLT                   71 - 126
//

Text Mined References (1)

PMID Year Title