Property Summary

NCBI Gene PubMed Count 9
PubMed Score 28.36
PubTator Score 8.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -1.300 2.2e-03
intraductal papillary-mucinous carcinoma... -1.200 6.7e-03
lung adenocarcinoma -1.300 1.2e-03
lung cancer -1.700 6.7e-03
lung carcinoma -1.800 3.6e-09
malignant mesothelioma 1.600 2.1e-04
nephrosclerosis -1.497 2.4e-02
non-small cell lung cancer -1.474 6.8e-10
osteosarcoma -3.295 4.4e-05
pituitary cancer 1.100 2.3e-03
psoriasis -1.400 3.1e-03
Rheumatoid arthritis 2.000 8.4e-03

Gene RIF (7)

AA Sequence

MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQKPQEPQKSPEPSLPSAPPNV      1 - 70
SEEKLRSLSLSEFEEGSYGWRNFHPQCLQRCNTPGGFLLHYCLLAVTQGIVVNGLVNISISTVEKRYEMK     71 - 140
SSLTGLISSSYDISFCLLSLFVSFFGERGHKPRWLAFAAFMIGLGALVFSLPQFFSGEYKLGSLFEDTCV    141 - 210
TTRNSTSCTSSTSSLSNYLYVFILGQLLLGAGGTPLYTLGTAFLDDSVPTHKSSLYIGTGYAMSILGPAI    211 - 280
GYVLGGQLLTIYIDVAMGESTDVTEDDPRWLGAWWIGFLLSWIFAWSLIIPFSCFPKHLPGTAEIQAGKT    281 - 350
SQAHQSNSNADVKFGKSIKDFPAALKNLMKNAVFMCLVLSTSSEALITTGFATFLPKFIENQFGLTSSFA    351 - 420
ATLGGAVLIPGAALGQILGGFLVSKFRMTCKNTMKFALFTSGVALTLSFVFMYAKCENEPFAGVSESYNG    421 - 490
TGELGNLIAPCNANCNCSRSYYYPVCGDGVQYFSPCFAGCSNPVAHRKPKVYYNCSCIERKTEITSTAET    491 - 560
FGFEAKAGKCETHCAKLPIFLCIFFIVIIFTFMAGTPITVSILRCVNHRQRSLALGIQFMVLRLLGTIPG    561 - 630
PIIFGFTIDSTCILWDINDCGIKGACWIYDNIKMAHMLVAISVTCKVITMFFNGFAIFLYKPPPSATDVS    631 - 700
FHKENAVVTNVLAEQDLNKIVKEG                                                  701 - 724
//

Text Mined References (11)

PMID Year Title