Property Summary

NCBI Gene PubMed Count 9
PubMed Score 25.59
PubTator Score 8.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 2.000 0.008
nephrosclerosis -1.497 0.024
malignant mesothelioma 1.600 0.000
psoriasis -2.400 0.000
osteosarcoma -3.295 0.000
non-small cell lung cancer -1.474 0.000
intraductal papillary-mucinous adenoma (... -1.300 0.002
intraductal papillary-mucinous carcinoma... -1.200 0.007
lung cancer -4.000 0.000
lung adenocarcinoma -1.900 0.000
lung carcinoma -1.800 0.000
pituitary cancer 1.100 0.002

Synonym

Accession Q6ZQN7 Q86UG5
Symbols OATPX
OATP-H
OATP-M1
OATP4C1
PRO2176
SLC21A20

Gene

PANTHER Protein Class (1)

Gene RIF (7)

PMID Text
20691413 single-nucleotide polymorphisms and haplotypes in SLCO4C1 in blacks are significantly associated with preeclampsia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20610891 In conclusion, we found that estrone 3-sulfate is a novel substrate for OATP4C1. Moreover, our results indicate that estrone 3-sulfate does not bind to the recognition site for digoxin in OATP4C1.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19875811 overexpression of human kidney-specific organic anion transporter SLCO4C1 in rat kidney reduced hypertension, cardiomegaly, and inflammation in the setting of renal failure
19197249 Observational study of gene-disease association. (HuGE Navigator)
14993604 isolation, cloning, and activity in the transport pathway of digoxin in the kidney

AA Sequence

MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQKPQEPQKSPEPSLPSAPPNV      1 - 70
SEEKLRSLSLSEFEEGSYGWRNFHPQCLQRCNTPGGFLLHYCLLAVTQGIVVNGLVNISISTVEKRYEMK     71 - 140
SSLTGLISSSYDISFCLLSLFVSFFGERGHKPRWLAFAAFMIGLGALVFSLPQFFSGEYKLGSLFEDTCV    141 - 210
TTRNSTSCTSSTSSLSNYLYVFILGQLLLGAGGTPLYTLGTAFLDDSVPTHKSSLYIGTGYAMSILGPAI    211 - 280
GYVLGGQLLTIYIDVAMGESTDVTEDDPRWLGAWWIGFLLSWIFAWSLIIPFSCFPKHLPGTAEIQAGKT    281 - 350
SQAHQSNSNADVKFGKSIKDFPAALKNLMKNAVFMCLVLSTSSEALITTGFATFLPKFIENQFGLTSSFA    351 - 420
ATLGGAVLIPGAALGQILGGFLVSKFRMTCKNTMKFALFTSGVALTLSFVFMYAKCENEPFAGVSESYNG    421 - 490
TGELGNLIAPCNANCNCSRSYYYPVCGDGVQYFSPCFAGCSNPVAHRKPKVYYNCSCIERKTEITSTAET    491 - 560
FGFEAKAGKCETHCAKLPIFLCIFFIVIIFTFMAGTPITVSILRCVNHRQRSLALGIQFMVLRLLGTIPG    561 - 630
PIIFGFTIDSTCILWDINDCGIKGACWIYDNIKMAHMLVAISVTCKVITMFFNGFAIFLYKPPPSATDVS    631 - 700
FHKENAVVTNVLAEQDLNKIVKEG                                                  701 - 724
//

Text Mined References (11)

PMID Year Title
20691413 2010 Genetic variation in solute carrier genes is associated with preeclampsia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20610891 2010 Transport of estrone 3-sulfate mediated by organic anion transporter OATP4C1: estrone 3-sulfate binds to the different recognition site for digoxin in OATP4C1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19875811 2009 SLCO4C1 transporter eliminates uremic toxins and attenuates hypertension and renal inflammation.
19197249 2009 Steroid biosynthesis and renal excretion in human essential hypertension: association with blood pressure and endogenous ouabain.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17314201 2007 Transport of the dipeptidyl peptidase-4 inhibitor sitagliptin by human organic anion transporter 3, organic anion transporting polypeptide 4C1, and multidrug resistance P-glycoprotein.
14993604 2004 Isolation and characterization of a digoxin transporter and its rat homologue expressed in the kidney.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...