Property Summary

NCBI Gene PubMed Count 2
PubMed Score 6.22
PubTator Score 0.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.9e-43

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 1.9e-43

AA Sequence

MATYCDDLGPSSAPPGQAQATAHPPGYEPGDLGAVGGGPLLWVNAPALSPKSYASGPGPAPPYAAPSYGA      1 - 70
PGPLLGAPGGLAGADLAWLSLSGQQELLRLVRPPYSYSALIAMAIQSAPLRKLTLSQIYQYVAGNFPFYK     71 - 140
RSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRAEASAAVRSGAR    141 - 210
SVGGAEAPALEPPSAACLDLQASPSPSAPEAATCFSGFASAMSALAGGLGTFPGGLAGDFSFGRRPPTVA    211 - 280
THAPQTLNPSPGFAPGHQTAAAGFRLSHLLYSREGTEV                                    281 - 318
//

Text Mined References (4)

PMID Year Title