Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MVSSFAGIREIEKLRHKEVNKSQQGTGPGLEPRGSNSRTSATSSGTKRQLHRVLRGQWLSSSAPVSSAEP      1 - 70
KASHLCIQGLSSSPIHHQGPVILPVDARLSLDVSVPEQRCSSYYLGRLWPQKYLVSSHSVKWN            71 - 133
//

Text Mined References (5)

PMID Year Title