Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZP98
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MVSSFAGIREIEKLRHKEVNKSQQGTGPGLEPRGSNSRTSATSSGTKRQLHRVLRGQWLSSSAPVSSAEP      1 - 70
KASHLCIQGLSSSPIHHQGPVILPVDARLSLDVSVPEQRCSSYYLGRLWPQKYLVSSHSVKWN            71 - 133
//

Text Mined References (5)

PMID Year Title
23738518 2013 A genome-wide association study for reading and language abilities in two population cohorts.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
21042317 2012 Genome-wide association study of major depressive disorder: new results, meta-analysis, and lessons learned.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.