Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.84
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MRLNIAIFFGALFGALGVLLFLVAFGSDYWLLATEVGRCSGEKNIENVTFHHEGFFWRCWFNGIVEENDS      1 - 70
NIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSYDSAVIYRGFWAVLMLLGVVAVVIASFLIICAAPF     71 - 140
ASHFLYKAGGGSYIAAGILFSLVVMLYVIWVQAVADMESYRNMKMKDCLDFTPSVLYGWSFFLAPAGIFF    141 - 210
SLLAGLLFLVVGWHIQIHH                                                       211 - 229
//

Text Mined References (9)

PMID Year Title