Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.95
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6ZP65 A8MUC8 B4DWL0 B5MDJ0 O95000
Symbols BICDR1
CCDC64
BICDR-1
CCDC64A
H_267D11.1

Gene

Gene RIF (2)

PMID Text
21555518 CCDC64 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSAFCLGLVGRASAPAEPDSACCMELPAAAGDAVRSPAAAAALIFPGGSGELELALEEELALLAAGERPS      1 - 70
DPGEHPQAEPGSLAEGAGPQPPPSQDPELLSVIRQKEKDLVLAARLGKALLERNQDMSRQYEQMHKELTD     71 - 140
KLEHLEQEKHELRRRFENREGEWEGRVSELESDVKQLQDELERQQIHLREADREKSRAVQELSEQNQRLL    141 - 210
DQLSRASEVERQLSMQVHALREDFREKNSSTNQHIIRLESLQAEIKMLSDRKRELEHRLSATLEENDLLQ    211 - 280
GTVEELQDRVLILERQGHDKDLQLHQSQLELQEVRLSCRQLQVKVEELTEERSLQSSAATSTSLLSEIEQ    281 - 350
SMEAEELEQEREQLRLQLWEAYCQVRYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRTALN    351 - 420
ELKRLIQSIVDGMEPTVTLLSVEMTALKEERDRLRVTSEDKEPKEQLQKAIRDRDEAIAKKNAVELELAK    421 - 490
CRMDMMSLNSQLLDAIQQKLNLSQQLEAWQDDMHRVIDRQLMDTHLKERSQPAAALCRGHSAGRGDEPSI    491 - 560
AEGKRLFSFFRKI                                                             561 - 573
//

Text Mined References (7)

PMID Year Title
26822037 2016 Bicaudal D Family of Motor Adaptors: Linking Dynein Motility to Cargo Binding.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20360680 2010 Pericentrosomal targeting of Rab6 secretory vesicles by Bicaudal-D-related protein 1 (BICDR-1) regulates neuritogenesis.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
16541075 2006 The finished DNA sequence of human chromosome 12.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.