Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.73
PubTator Score 4.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
juvenile dermatomyositis 1189 2.72655847459132E-9
atypical teratoid/rhabdoid tumor 1095 0.00135489400470723
sarcoidosis 368 0.00341097246232789
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0
Disease Target Count Z-score Confidence
Waardenburg's syndrome 16 3.303 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.169 0.000
sarcoidosis 1.100 0.003
atypical teratoid/rhabdoid tumor 1.100 0.001

Synonym

Accession Q6ZN18 Q59FS5 Q6ZN62 Q96BG3
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Chicken OMA Inparanoid
Anole lizard EggNOG Inparanoid

Gene RIF (3)

PMID Text
25915901 retrotransposons as promoter, which display partial DNA methylation pattern of allelic- or non-allelic origin during different stages of development
23110252 The first three-dimensional structure of the human polycomb repressive complex 2 complex bound to its cofactor AEBP2 has been presented.
18854154 Knockdown of AE binding protein 2 (AEBP2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MAAAITDMADLEELSRLSPLPPGSPGSAARGRAEPPEEEEEEEEEEEEAEAEAVAALLLNGGSGGGGGGG      1 - 70
GGGVGGGEAETMSEPSPESASQAGEDEDEEEDDEEEEDESSSSGGGEEESSAESLVGSSGGSSSDETRSL     71 - 140
SPGAASSSSGDGDGKEGLEEPKGPRGSQGGGGGGSSSSSVVSSGGDEGYGTGGGGSSATSGGRRGSLEMS    141 - 210
SDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLAD    211 - 280
HIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVP    281 - 350
THFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIE    351 - 420
SLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDP    421 - 490
NIYRTMPQKRLKRTLIRKVFNLYLSKQ                                               491 - 517
//

Text Mined References (23)

PMID Year Title
25915901 2015 Retrotransposon-derived promoter of Mammalian Aebp2.
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23110252 2012 Molecular architecture of human polycomb repressive complex 2.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20075857 2010 JARID2 regulates binding of the Polycomb repressive complex 2 to target genes in ES cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...