Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.85
PubTator Score 4.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
juvenile dermatomyositis 1187 2.7e-09
atypical teratoid/rhabdoid tumor 357 1.4e-03
sarcoidosis 370 3.4e-03
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.5
Disease Target Count Z-score Confidence
Waardenburg's syndrome 17 3.326 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 1.4e-03
juvenile dermatomyositis 1.169 2.7e-09
sarcoidosis 1.100 3.4e-03

Protein-protein Interaction (6)

Gene RIF (3)

AA Sequence

MAAAITDMADLEELSRLSPLPPGSPGSAARGRAEPPEEEEEEEEEEEEAEAEAVAALLLNGGSGGGGGGG      1 - 70
GGGVGGGEAETMSEPSPESASQAGEDEDEEEDDEEEEDESSSSGGGEEESSAESLVGSSGGSSSDETRSL     71 - 140
SPGAASSSSGDGDGKEGLEEPKGPRGSQGGGGGGSSSSSVVSSGGDEGYGTGGGGSSATSGGRRGSLEMS    141 - 210
SDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLAD    211 - 280
HIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVP    281 - 350
THFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIE    351 - 420
SLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDP    421 - 490
NIYRTMPQKRLKRTLIRKVFNLYLSKQ                                               491 - 517
//

Text Mined References (23)

PMID Year Title