Property Summary

NCBI Gene PubMed Count 11
Grant Count 7
R01 Count 7
Funding $479,282.25
PubMed Score 9.73
PubTator Score 4.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.169 0.000
sarcoidosis 1.100 0.003
atypical teratoid/rhabdoid tumor 1.100 0.001

Gene RIF (3)

PMID Text
25915901 retrotransposons as promoter, which display partial DNA methylation pattern of allelic- or non-allelic origin during different stages of development
23110252 The first three-dimensional structure of the human polycomb repressive complex 2 complex bound to its cofactor AEBP2 has been presented.
18854154 Knockdown of AE binding protein 2 (AEBP2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MAAAITDMADLEELSRLSPLPPGSPGSAARGRAEPPEEEEEEEEEEEEAEAEAVAALLLNGGSGGGGGGG      1 - 70
GGGVGGGEAETMSEPSPESASQAGEDEDEEEDDEEEEDESSSSGGGEEESSAESLVGSSGGSSSDETRSL     71 - 140
SPGAASSSSGDGDGKEGLEEPKGPRGSQGGGGGGSSSSSVVSSGGDEGYGTGGGGSSATSGGRRGSLEMS    141 - 210
SDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLAD    211 - 280
HIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVP    281 - 350
THFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIE    351 - 420
SLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDP    421 - 490
NIYRTMPQKRLKRTLIRKVFNLYLSKQ                                               491 - 517
//

Text Mined References (23)

PMID Year Title
25915901 2015 Retrotransposon-derived promoter of Mammalian Aebp2.
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23110252 2012 Molecular architecture of human polycomb repressive complex 2.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20075857 2010 JARID2 regulates binding of the Polycomb repressive complex 2 to target genes in ES cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...