Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.38254042424269E-25
glioblastoma 5572 5.20940746411781E-4
medulloblastoma, large-cell 6234 5.2579760230336E-4
group 3 medulloblastoma 2254 0.0133208729262308

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma -1.500 0.001
medulloblastoma, large-cell -1.100 0.001
group 3 medulloblastoma 1.100 0.013
lung carcinoma 1.300 0.000

Synonym

Accession Q6ZN11 E9PGN4 Q7Z3Q9
Symbols

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG

Gene RIF (1)

PMID Text
26545406 B3GAT2 and ZNF793 are hypermethylated in BE, and the methylation status of these genes can be used to detect BE in tissue samples.

AA Sequence

MIEYQIPVSFKDVVVGFTQEEWHRLSPAQRALYRDVMLETYSNLVSVGYEGTKPDVILRLEQEEAPWIGE      1 - 70
AACPGCHCWEDIWRVNIQRKRRQDMLLRPGAAISKKTLPKEKSCEYNKFGKISLLSTDLFSSIQSPSNWN     71 - 140
PCGKNLNHNLDLIGFKRNCAKKQDECYAYGKLLQRINHGRRPNGEKPRGCSHCEKAFTQNPALMYKPAVS    141 - 210
DSLLYKRKRVPPTEKPHVCSECGKAFCYKSEFIRHQRSHTGEKPYGCTDCGKAFSHKSTLIKHQRIHTGV    211 - 280
RPFECFFCGKAFTQKSHRTEHQRTHTGERPFVCSECGKSFGEKSYLNVHRKMHTGERPYRCRECGKSFSQ    281 - 350
KSCLNKHWRTHTGEKPYGCNECGKAFYQKPNLSRHQKIHARKNAYRNENLIIVGNT                  351 - 406
//

Text Mined References (6)

PMID Year Title
26545406 2015 Methylated B3GAT2 and ZNF793 Are Potential Detection Biomarkers for Barrett's Esophagus.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.