Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 1.4e-25
glioblastoma 5792 5.2e-04
medulloblastoma, large-cell 6241 5.3e-04
group 3 medulloblastoma 4104 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma -1.500 5.2e-04
group 3 medulloblastoma 1.100 1.3e-02
lung carcinoma 1.300 1.4e-25
medulloblastoma, large-cell -1.100 5.3e-04

Gene RIF (1)

AA Sequence

MIEYQIPVSFKDVVVGFTQEEWHRLSPAQRALYRDVMLETYSNLVSVGYEGTKPDVILRLEQEEAPWIGE      1 - 70
AACPGCHCWEDIWRVNIQRKRRQDMLLRPGAAISKKTLPKEKSCEYNKFGKISLLSTDLFSSIQSPSNWN     71 - 140
PCGKNLNHNLDLIGFKRNCAKKQDECYAYGKLLQRINHGRRPNGEKPRGCSHCEKAFTQNPALMYKPAVS    141 - 210
DSLLYKRKRVPPTEKPHVCSECGKAFCYKSEFIRHQRSHTGEKPYGCTDCGKAFSHKSTLIKHQRIHTGV    211 - 280
RPFECFFCGKAFTQKSHRTEHQRTHTGERPFVCSECGKSFGEKSYLNVHRKMHTGERPYRCRECGKSFSQ    281 - 350
KSCLNKHWRTHTGEKPYGCNECGKAFYQKPNLSRHQKIHARKNAYRNENLIIVGNT                  351 - 406
//

Text Mined References (6)

PMID Year Title