Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGPLQFRDVAIEFSLEEWHCLDMAQRNLYRDVMLENYRNLVFLGIVVSKPDLITHLEQGKKPSTMQRHEM      1 - 70
VANPSVLCSHFNQDLWPEQSIKDSFQKLILRRHKKCGHDNLQLKKGCESVDKCKVHKRGYNGLNQCLTTT     71 - 140
QSKMFQCDKHGKVFHQFSNTNRHKIRHTGKNPCKFTECGKAFNRSSTFTTHKKIHTGEKPYKCIECGKAF    141 - 210
NRSSHLTTHKIIHTGEKRYKCEDCGKAFNRSSNLTTHKKIHTGEKPYKCEECGKAFKRSSILTTHKRIHT    211 - 280
GEKPYKCEECGKVFKYLSSLSTHKIIHTGEKPYKCEECGKAFNWSSHLTTHKRIHTGEKPYKCEECGKGF    281 - 350
KYSSTLTKHKIIHTGEKPYKCEECGEAFKYSCSLTAHKIIHTGKKPYKCEECGKVFKHSSPLSKHKRIHT    351 - 420
GEKPYKCEECGKAFSRSSILTTHKIIHTGEKPYECEDCGKAFNRSSNLTKHKKIHTGEKPYKCEECGKAF    421 - 490
KCSSILTTHKRIHTADKPYKCEECGKDFKYSSTLTRHKKIHTGGKPHKCNKCGKAFISSSNLSRHEIIHM    491 - 560
GGNPYKCENVAKP                                                             561 - 573
//

Text Mined References (6)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
1946370 1991 Characterization and mapping of human genes encoding zinc finger proteins.
1505991 1992 Clustering of C2-H2 zinc finger motif sequences within telomeric and fragile site regions of human chromosomes.