Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.70
PubTator Score 1.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.6e-02
cystic fibrosis -1.221 6.6e-05
group 3 medulloblastoma 2.800 4.7e-05
medulloblastoma, large-cell 2.200 3.9e-05
osteosarcoma 2.824 6.5e-04
primitive neuroectodermal tumor 1.900 7.4e-03

Gene RIF (2)

AA Sequence

MPSSLFADLERNGSGGGGGGSSGGGETLDDQRALQLALDQLSLLGLDSDEGASLYDSEPRKKSVNMTECV      1 - 70
PVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAMARREIISAAEHFSMIRAS     71 - 140
RNKNTALNGAVPGPPNLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGM    141 - 210
PENVDRAREEIEAHIALRTGGIIELTDENDFHANGTDVGFDLHHGSGGSGPGSLWSKPTPSITPTPGRKP    211 - 280
FSSYRNDSSSSLGSASTDSYFGGGTSSSAAATQRLADYSPPSPALSFAHNGNNNNNGNGYTYTAGGEASV    281 - 350
PSPDGCPELQPTFDPAPAPPPGAPLIWAQFERSPGGGPAAPVSSSCSSSASSSASSSSVVFPGGGASAPS    351 - 420
NANLGLLVHRRLHPGTSCPRLSPPLHMAPGAGEHHLARRVRSDPGGGGLAYAAYANGLGAQLPGLQPSDT    421 - 490
SGSSSSSSSSSSSSSSSSGLRRKGSRDCSVCFESEVIAALVPCGHNLFCMECANRICEKSEPECPVCHTA    491 - 560
VTQAIRIFS                                                                 561 - 569
//

Text Mined References (18)

PMID Year Title