Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 5.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Multiple Sclerosis 498 1.0
Osteoporosis 257 2.0

Expression

Gene RIF (2)

PMID Text
25898001 SNPs in LEKR1 and GALNT10 modulate sex-difference in carotid intima-media thickness.
22073261 birth weight lowering effect of the C-allele of rs900400 located near LEKR1 and CCNL1 was replicated in the Danish population. Furthermore the C-allele was associated with increased insulin response following oral glucose stimulation

AA Sequence

MLLKEKEDSLMTCQQIYKALQEELTVKEKQEEDIKRRINLAENELEITKTLLNQTREEVLTLKNERELML      1 - 70
ISHQKSIEQLQETLRQKLLSDDNWKEKIEAELAKERAQHLVEFEEQALLFKEETKLQLDIEKEKHQDVIQ     71 - 140
KYKKEQEELQMKISDLITGATRDLRQEVTTLKEKLHKSHIRYTEESNSKEKEIENLKNLVAEFESRLKKE    141 - 210
IDSNDSVSENLRKEMEQKSDELKRVMLAQTQLIEQFNQSQEENTFLQETVRRECEERFELTEALSQAREQ    211 - 280
LLELSKLRGSLPFSPCSLSKGSLTSPAAAVSNHGERSLARLNSEKGIQIPNLRGVSKPTTFPTSDKPKRV    281 - 350
RSGVPILPQPHPPRGGASSANETRQRLAAILRRRRSQQ                                    351 - 388
//

Text Mined References (13)

PMID Year Title
25898001 2015 Genetic variants in LEKR1 and GALNT10 modulate sex-difference in carotid intima-media thickness: a genome-wide interaction study.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
23575227 2013 The chromosome 3q25 genomic region is associated with measures of adiposity in newborns in a multi-ethnic genome-wide association study.
22911880 2012 Genome-wide association analysis of eating disorder-related symptoms, behaviors, and personality traits.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22073261 2011 The birth weight lowering C-allele of rs900400 near LEKR1 and CCNL1 associates with elevated insulin release following an oral glucose challenge.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
20372150 2010 Variants in ADCY5 and near CCNL1 are associated with fetal growth and birth weight.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
More...