Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.53
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis and chronic rhinosinusit... -1.962 2.9e-02
ependymoma 2.400 4.6e-02
lung adenocarcinoma -1.100 3.0e-04
lung carcinoma -3.500 5.0e-15
non-small cell lung carcinoma -1.300 1.9e-08

Gene RIF (1)

AA Sequence

MHDECTPQQTMSSIQDTKAADIAARGELNVIETATVSPTNGEESHYTNQVQLEKNKTHMSSALVEKENNT      1 - 70
SLNGRVLGQEESQNKMFPDNAENEDDKQIEHMTVENINGNREETHGIIQTTETEIQETSESPREEMTTSS     71 - 140
IICDISKKYINSTLPNDSENIKHKNNIMEKEYLDVLSDVTGPQVSCYITAPSYVLQQLECRIINHMSSLI    141 - 210
VGDNEELVSNVITIECSDKEKRVPFPIGIAIPFTARYRGNYRDIMVKVCDINLQSSYLNPNSLEGMKGGY    211 - 280
KGTCASVKVYKLGIFSVVSCLKKESFTVTKKGLALKSSMDSRISLNYPPGVFTSPVLVQLKIQPVDPALV    281 - 350
AHLKAQQDTFYSVQSTSPLIHIQHPSTYPFQKPVTLFLPCSPYLDKNNLGSEIDHKRRASATINRITPSY    351 - 420
FNRTKIASIRKPRKNASECLKLLGFRSQDSGWCGLDDVVKTIQSGLVSVELYEHLERFIVLHLSSTMDNS    421 - 490
HLVTFVKSLEEAMLSTTACIVLSHQKDNPHRIAVLVVPSKDLSQVLKDLHLEGFGGPPEPSRHFQVREGE    491 - 560
QLLLRFTGNIFASSNGKDYGKDYTLIFHLQRKPRLELQIKEVDEFGNYSCPHYKGTIVVYKVPKGKIVPN    561 - 630
LNQSLVINENHSQLPICKLPLKLPKHKKLINRPQSTKRVSKDPVEALWDNLLHWLAEELSEENAESLSST    631 - 700
LPLRRSTIQLIKLKNPDDLTEQIHEFLCFWKKSLPTFTDKLRLLARHLRKIGRSDLAEELKFKWENKVFT    701 - 770
EPQQCFDVAPE                                                               771 - 781
//

Text Mined References (8)

PMID Year Title