Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.5e-06
psoriasis 6694 5.0e-04
lung cancer 4740 1.1e-03

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.300 1.1e-03
osteosarcoma -1.693 1.5e-06
psoriasis -1.200 5.0e-04

AA Sequence

MAEAAPARDPETDKHTEDQSPSTPLPQPAAEKNSYLYSTEITLWTVVAAIQALEKKVDSCLTRLLTLEGR      1 - 70
TGTAEKKLADCEKTAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEAPK     71 - 140
VPVTFDDVAVYFSELEWGKLEDWQKELYKHVMRGNYETLVSLDYAISKPDILTRIERGEEPCLDRWGQEK    141 - 210
GNEVEVGRPRMMGTGLPPYPEHLTSPLSPAQEELKEGQAPKQQQDSEARVAPAGPEAGLALRTDLQGEAQ    211 - 280
I//

Text Mined References (10)

PMID Year Title