Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.80
PubTator Score 8.28

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Gene RIF (2)

AA Sequence

MAFPCRRSLTAKTLACLLVGVSFLALQQWFLQAPRSPREERSPQEETPEGPTDAPAADEPPSELVPGPPC      1 - 70
VANASANATADFEQLPARIQDFLRYRHCRHFPLLWDAPAKCAGGRGVFLLLAVKSAPEHYERRELIRRTW     71 - 140
GQERSYGGRPVRRLFLLGTPGPEDEARAERLAELVALEAREHGDVLQWAFADTFLNLTLKHLHLLDWLAA    141 - 210
RCPHARFLLSGDDDVFVHTANVVRFLQAQPPGRHLFSGQLMEGSVPIRDSWSKYFVPPQLFPGSAYPVYC    211 - 280
SGGGFLLSGPTARALRAAARHTPLFPIDDAYMGMCLERAGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYR    281 - 350
ELLLVHRFAPYEMLLMWKALHSPALSCDRGHRVS                                        351 - 384
//

Text Mined References (12)

PMID Year Title