Property Summary

NCBI Gene PubMed Count 22
PubMed Score 9.41
PubTator Score 53.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.694 0.000
malignant mesothelioma -1.500 0.000
psoriasis -1.800 0.000
osteosarcoma -2.785 0.000
atypical teratoid / rhabdoid tumor 2.000 0.000
glioblastoma 1.500 0.000
tuberculosis -1.200 0.000
lung cancer -2.800 0.000
interstitial cystitis -1.400 0.000

Synonym

Accession Q6XZF7 Q8IVY3 Q9Y2L3
Symbols TUBA
ARHGEF36

Gene

PDB

4CC2   4CC7   1UG1   1UHC   4CC3   4CC4   4GLM  

Gene RIF (14)

PMID Text
25801238 The rs3740058 in DNMBP was significantly differently in genotype between Alaheimer diease and control in APOE epsilon4epsilon4 subgroup, but showed no effect on Alzheimer disease risk, either did rs11190305 polymorphisms in DNMBP.
25422375 Cdc42 and its specific guanine nucleotide-exchange factor (GEF), Tuba, localize to linear invadosomes, and both are required for linear invadosome formation
21677511 Polyproline region of N-WASP is required for the localization of Tuba at the pre-apical patch.
18452187 Although DNMBP is an excellent candidate gene because of its role in the APP recycling pathways and being located within a chromosome 10 linkage region, we are unable to confirm that DNMBP is associated with LOAD
18452187 Observational study of gene-disease association. (HuGE Navigator)
18359537 findings underscore a role for DNMBP in the genetic risk for late-onset Alzheimer's disease in the Belgian population
18359537 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17442457 We observed no association of statistical significance in either the total sample or the APOE*4 non-carriers for any of the SNPs of Dynamin Binding Protein.
17442457 Observational study of gene-disease association. (HuGE Navigator)
17015620 Tuba controls the shaping of cell junctions through the local activation of Cdc42 and its effectors.
More...

AA Sequence

MEAGSVVRAIFDFCPSVSEELPLFVGDIIEVLAVVDEFWLLGKKEDVTGQFPSSFVEIVTIPSLKEGERL      1 - 70
FVCICEFTSQELDNLPLHRGDLVILDGIPTAGWLQGRSCWGARGFFPSSCVRELCLSSQSRQWHSQSALF     71 - 140
QIPEYSMGQARALMGLSAQLDEELDFREGDVITIIGVPEPGWFEGELEGRRGIFPEGFVELLGPLRTVDE    141 - 210
SVSSGNQDDCIVNGEVDTPVGEEEIGPDEDEEEPGTYGVALYRFQALEPNELDFEVGDKIRILATLEDGW    211 - 280
LEGSLKGRTGIFPYRFVKLCPDTRVEETMALPQEGSLARIPETSLDCLENTLGVEEQRHETSDHEAEEPD    281 - 350
CIISEAPTSPLGHLTSEYDTDRNSYQDEDTAGGPPRSPGVEWEMPLATDSPTSDPTEVVNGISSQPQVPF    351 - 420
HPNLQKSQYYSTVGGSHPHSEQYPDLLPLEARTRDYASLPPKRMYSQLKTLQKPVLPLYRGSSVSASRVV    421 - 490
KPRQSSPQLHNLASYTKKHHTSSVYSISERLEMKPGPQAQGLVMEAATHSQGDGSTDLDSKLTQQLIEFE    491 - 560
KSLAGPGTEPDKILRHFSIMDFNSEKDIVRGSSKLITEQELPERRKALRPPPPRPCTPVSTSPHLLVDQN    561 - 630
LKPAPPLVVRPSRPAPLPPSAQQRTNAVSPKLLSRHRPTCETLEKEGPGHMGRSLDQTSPCPLVLVRIEE    631 - 700
MERDLDMYSRAQEELNLMLEEKQDESSRAETLEDLKFCESNIESLNMELQQLREMTLLSSQSSSLVAPSG    701 - 770
SVSAENPEQRMLEKRAKVIEELLQTERDYIRDLEMCIERIMVPMQQAQVPNIDFEGLFGNMQMVIKVSKQ    771 - 840
LLAALEISDAVGPVFLGHRDELEGTYKIYCQNHDEAIALLEIYEKDEKIQKHLQDSLADLKSLYNEWGCT    841 - 910
NYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEINVNINEYKRRKDLVLKYRKG    911 - 980
DEDSLMEKISKLNIHSIIKKSNRVSSHLKHLTGFAPQIKDEVFEETEKNFRMQERLIKSFIRDLSLYLQH    981 - 1050
IRESACVKVVAAVSMWDVCMERGHRDLEQFERVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHKL   1051 - 1120
VQKRFDKLLDFYNCTERAEKLKDKKTLEELQSARNNYEALNAQLLDELPKFHQYAQGLFTNCVHGYAEAH   1121 - 1190
CDFVHQALEQLKPLLSLLKVAGREGNLIAIFHEEHSRVLQQLQVFTFFPESLPATKKPFERKTIDRQSAR   1191 - 1260
KPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLID   1261 - 1330
NGVTKGFVYSSFLKPYNPRRSHSDASVGSHSSTESEHGSSSPRFPRQNSGSTLTFNPSSMAVSFTSGSCQ   1331 - 1400
KQPQDASPPPKECDQGTLSASLNPSNSESSPSRCPSDPDSTSQPRSGDSADVARDVKQPTATPRSYRNFR   1401 - 1470
HPEIVGYSVPGRNGQSQDLVKGCARTAQAPEDRSTEPDGSEAEGNQVYFAVYTFKARNPNELSVSANQKL   1471 - 1540
KILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT                                    1541 - 1577
//

Text Mined References (28)

PMID Year Title
26660717 2016 The proline-rich region of glyceraldehyde-3-phosphate dehydrogenase from human sperm may bind SH3 domains, as revealed by a bioinformatic study of low-complexity protein segments.
25801238 2015 Genetic association of CUGBP2 and DNMBP with Alzheimer' s disease in the Chinese Han population.
25422375 2014 Discoidin domain receptor 1 controls linear invadosome formation via a Cdc42-Tuba pathway.
25097232 2014 Tricellulin regulates junctional tension of epithelial cells at tricellular contacts through Cdc42.
24332715 2014 Structural details of human tuba recruitment by InlC of Listeria monocytogenes elucidate bacterial cell-cell spreading.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21677511 Tuba and N-WASP function cooperatively to position the central lumen during epithelial cyst morphogenesis.
21269460 2011 Initial characterization of the human central proteome.
More...