Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Gene RIF (10)

AA Sequence

MTQEKMYPHLFSERCANQHQHRTAEEKKYVSEKQLIHWRCEEPSAHHNSIDIKRMKHFGSALRLRQTFHL      1 - 70
DTADHPCVITMNPALPWKLEGSNSTSTLPLPA                                           71 - 102
//

Text Mined References (14)

PMID Year Title