Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6XLA1 D3DRC5
Symbols C10orf5

Gene

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
25446261 CASC2 plays a tumor suppressive role in glioma via negative regulation of miR-21, which may be a novel therapeutic target for treating gliomas.
15024726 Identification of CASC2, in a region of common allelic loss at chromosome 10q26 in endometrial cancer.

AA Sequence

MTQEKMYPHLFSERCANQHQHRTAEEKKYVSEKQLIHWRCEEPSAHHNSIDIKRMKHFGSALRLRQTFHL      1 - 70
DTADHPCVITMNPALPWKLEGSNSTSTLPLPA                                           71 - 102
//

Text Mined References (5)

PMID Year Title
25446261 2015 Long non-coding RNA CASC2 suppresses malignancy in human gliomas by miR-21.
17352238 CASC2a gene is down-regulated in endometrial cancer.
15024726 2004 Identification of a novel candidate gene, CASC2, in a region of common allelic loss at chromosome 10q26 in human endometrial cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.