Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
25446261 CASC2 plays a tumor suppressive role in glioma via negative regulation of miR-21, which may be a novel therapeutic target for treating gliomas.
15024726 Identification of CASC2, in a region of common allelic loss at chromosome 10q26 in endometrial cancer.

AA Sequence

MTQEKMYPHLFSERCANQHQHRTAEEKKYVSEKQLIHWRCEEPSAHHNSIDIKRMKHFGSALRLRQTFHL      1 - 70
DTADHPCVITMNPALPWKLEGSNSTSTLPLPA                                           71 - 102
//

Text Mined References (5)

PMID Year Title
25446261 2015 Long non-coding RNA CASC2 suppresses malignancy in human gliomas by miR-21.
17352238 CASC2a gene is down-regulated in endometrial cancer.
15024726 2004 Identification of a novel candidate gene, CASC2, in a region of common allelic loss at chromosome 10q26 in human endometrial cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.