Property Summary

NCBI Gene PubMed Count 10
Grant Count 13
R01 Count 13
Funding $668,806.76
PubMed Score 1.38
PubTator Score 1.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.552 0.000

 GO Function (1)

Gene RIF (2)

PMID Text
22399810 Rad9B responds to nucleolar stress after the activation of JNK-dependent stress signalling and ATR-dependent DNA damage response pathways, and actively accumulates within nucleoli, where it does not cause a transcription block.
16365875 The encoded mammalian proteins participate in promoting resistance to DNA damage, cell cycle checkpoint control, DNA repair, and apoptosis.

AA Sequence

MLKCVMSGSQVKVFGKAVQALSRISDEFWLDPSKKGLALRCVNSSRSAYGCVLFSPVFFQHYQWSALVKM      1 - 70
SENELDTTLHLKCKLGMKSILPIFRCLNSLERNIEKCRIFTRSDKCKVVIQFFYRHGIKRTHNICFQESQ     71 - 140
PLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVTLAVTPLNFCLKSSNEESMDLSNAVHSEMFVGSD    141 - 210
EFDFFQIGMDTEITFCFKELKGILTFSEATHAPISIYFDFPGKPLALSIDDMLVEANFILATLADEQSRA    211 - 280
SSPQSLCLSQKRKRSDLIEKKAGKNVTGQALECISKKAAPRRLYPKETLTNISALENCGSPAMKRVDGDV    281 - 350
SEVSESSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEEDMNNVCCRKEFNGSDA    351 - 420
KYFCII                                                                    421 - 426
//

Publication (11)

PMID Year Title
24013428 2013 Clamping down on mammalian meiosis.
22399810 2012 Rad9B responds to nucleolar stress through ATR and JNK signalling, and delays the G1-S transition.
16541075 2006 The finished DNA sequence of human chromosome 12.
16365875 2006 Rad9, an evolutionarily conserved gene with multiple functions for preserving genomic integrity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14611806 2003 Identification and characterization of RAD9B, a paralog of the RAD9 checkpoint gene.
14500360 2003 Expression of mammalian paralogues of HRAD9 and Mrad9 checkpoint control genes in normal and cancerous testicular tissue.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
More...