Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.44
PubTator Score 1.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 5.3e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.552 5.3e-06

Synonym

Accession Q6WBX8 Q5U5K0 Q6NVJ1 Q6ZVT7 Q8N7T9 Q96LI8
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Protein-protein Interaction (12)

Gene RIF (2)

AA Sequence

MLKCVMSGSQVKVFGKAVQALSRISDEFWLDPSKKGLALRCVNSSRSAYGCVLFSPVFFQHYQWSALVKM      1 - 70
SENELDTTLHLKCKLGMKSILPIFRCLNSLERNIEKCRIFTRSDKCKVVIQFFYRHGIKRTHNICFQESQ     71 - 140
PLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVTLAVTPLNFCLKSSNEESMDLSNAVHSEMFVGSD    141 - 210
EFDFFQIGMDTEITFCFKELKGILTFSEATHAPISIYFDFPGKPLALSIDDMLVEANFILATLADEQSRA    211 - 280
SSPQSLCLSQKRKRSDLIEKKAGKNVTGQALECISKKAAPRRLYPKETLTNISALENCGSPAMKRVDGDV    281 - 350
SEVSESSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEEDMNNVCCRKEFNGSDA    351 - 420
KYFCII                                                                    421 - 426
//

Text Mined References (11)

PMID Year Title