Property Summary

NCBI Gene PubMed Count 53
Grant Count 2
Funding $169,550
PubMed Score 171.12
PubTator Score 203.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6W4X9 O15329 Q14394 Q2TUQ5 Q4L207 Q8N8I1 Q8NAK1 MUC-6
Symbols MUC-6

Gene

 Grant Application (2)

Gene RIF (47)

PMID Text
25298197 In ovarian mucinous tumors, MUC6 expression changes with the progression of benign to borderline and malignant tumours
25124036 Human TTF2 is a lectin that binds alpha-GlcNAc-capped mucin 6 g with antibiotic activity against Helicobacter pylori.
24901817 There was no difference in the expression of deep MUC1, MUC2, MUC5AC, or MUC6 between the groups of gastric cancer and controls.
24840470 The expression of a subset of mucins (MUC2, MUC6, MUC5B) was also correlated with sialyl-Tn expression in LS174T cells.
24603585 CDX2, MUC1, MUC5AC, and MUC6 expression patterns may provide better estimations of survival after surgical resection of small intestinal adenocarcinoma.
23828549 High MUC6 expression is associated with gastric carcinoma.
23807779 we report the expression pattern of MUC2, MUC5AC, MUC5B, and MUC6 in a large series of colorectal carcinomas
23446997 Data indicate that MUC1 and MUC4 were differentially glycosylated as the disease progressed, and the expression of MUC6 in acinar cells.
23305535 Secretory carcinomas of breast show a unique pattern of strong MUC2, MUC6, and MUC 4 expression.
23163606 Overexpression of EZH2 may be associated with malignant behaviour in intraductal papillary neoplasm of the bile duct in parallel with up-regulated MUC1 expression and down-regulated MUC6 expression.
More...

AA Sequence

MVQRWLLLSCCGALLSAGLANTSYTSPGLQRLKDSPQTAPDKGQCSTWGAGHFSTFDHHVYDFSGTCNYI      1 - 70
FAATCKDAFPTFSVQLRRGPDGSISRIIVELGASVVTVSEAIISVKDIGVISLPYTSNGLQITPFGQSVR     71 - 140
LVAKQLELELEVVWGPDSHLMVLVERKYMGQMCGLCGNFDGKVTNEFVSEEGKFLEPHKFAALQKLDDPG    141 - 210
EICTFQDIPSTHVRQAQHARICTQLLTLVAPECSVSKEPFVLSCQADVAAAPQPGPQNSSCATLSEYSRQ    211 - 280
CSMVGQPVRRWRSPGLCSVGQCPANQVYQECGSACVKTCSNPQHSCSSSCTFGCFCPEGTVLNDLSNNHT    281 - 350
CVPVTQCPCVLHGAMYAPGEVTIAACQTCRCTLGRWVCTERPCPGHCSLEGGSFVTTFDARPYRFHGTCT    351 - 420
YILLQSPQLPEDGALMAVYDKSGVSHSETSLVAVVYLSRQDKIVISQDEVVTNNGEAKWLPYKTRNITVF    421 - 490
RQTSTHLQMATSFGLELVVQLRPIFQAYVTVGPQFRGQTRGLCGNFNGDTTDDFTTSMGIAEGTASLFVD    491 - 560
SWRAGNCPAALERETDPCSMSQLNKVCAETHCSMLLRTGTVFERCHATVNPAPFYKRCVYQACNYEETFP    561 - 630
HICAALGDYVHACSLRGVLLWGWRSSVDNCTIPCTGNTTFSYNSQACERTCLSLSDRATECHHSAVPVDG    631 - 700
CNCPDGTYLNQKGECVRKAQCPCILEGYKFILAEQSTVINGITCHCINGRLSCPQRPQMFLASCQAPKTF    701 - 770
KSCSQSSENKFGAACAPTCQMLATGVACVPTKCEPGCVCAEGLYENADGQCVPPEECPCEFSGVSYPGGA    771 - 840
ELHTDCRTCSCSRGRWACQQGTHCPSTCTLYGEGHVITFDGQRFVFDGNCEYILATDVCGVNDSQPTFKI    841 - 910
LTENVICGNSGVTCSRAIKIFLGGLSVVLADRNYTVTGEEPHVQLGVTPGALSLVVDISIPGRYNLTLIW    911 - 980
NRHMTILIRIARASQDPLCGLCGNFNGNMKDDFETRSRYVASSELELVNSWKESPLCGDVSFVTDPCSLN    981 - 1050
AFRRSWAERKCSVINSQTFATCHSKVYHLPYYEACVRDACGCDSGGDCECLCDAVAAYAQACLDKGVCVD   1051 - 1120
WRTPAFCPIYCGFYNTHTQDGHGEYQYTQEANCTWHYQPCLCPSQPQSVPGSNIEGCYNCSQDEYFDHEE   1121 - 1190
GVCVPCMPPTTPQPPTTPQLPTTGSRPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQTPLLPATLT   1191 - 1260
SSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATASTASPATTSTAQSTTRTTMT   1261 - 1330
LPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTGPTTPQPGQPTRPTATETTQTRTTTEYTTP   1331 - 1400
QTPHTTHSPPTAGSPVPSTGPVTATSFHATTTYPTPSHPETTLPTHVPPFSTSLVTPSTHTVITPTHAQM   1401 - 1470
ATSASNHSAPTGTIPPPTTLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTPT   1471 - 1540
STTTITPNPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSHPQT   1541 - 1610
TLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSMPTGTIPPPTTLKATGSTHTAPTMTLTTSGTSQ   1611 - 1680
ALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNPTSTGTPPMTVTTSGTSQSRSSFSTAKTSTSLH   1681 - 1750
SHTSSTHHPEVTSTSTTSITPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSF   1751 - 1820
QTTTTYPTPSHPHTTLPTHVPSFSTSLVTPSTHTVIIPTHTQMATSASIHSMPTGTIPPPTTIKATGSTH   1821 - 1890
TAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHTSSTHHPEVTPTSTTNITPKHTSTGTRTPVAHTTSASSS   1891 - 1960
RLPTPFTTHSPPTGSSPFSSTGPMTATSFQTTTTYPTPSHPQTTLPTHVPPFSTSLVTPSTHTVIITTHT   1961 - 2030
QMATSASIHSTPTGTVPPPTTLKATGSTHTAPPMTVTTSGTSQTHSSFSTATASSSFISSSSWLPQNSSS   2031 - 2100
RPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSPSVGTSSSFVSAPV   2101 - 2170
HSTTLSSGSHSSLSTHPTTASVSASPLFPSSPAASTTIRATLPHTISSPFTLSALLPISTVTVSPTPSSH   2171 - 2240
LASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTSLTTRVPTSGFVSLTSGVTGIPTSPVTNLTTRHPGP   2241 - 2310
TLSPTTRFLTSSLTAHGSTPASAPVSSLGTPTPTSPGVCSVREQQEEITFKGCMANVTVTRCEGACISAA   2311 - 2380
SFNIITQQVDARCSCCRPLHSYEQQLELPCPDPSTPGRRLVLTLQVFSHCVCSSVACGD              2381 - 2439
//

Text Mined References (53)

PMID Year Title
25298197 2015 Expression profile of mucins (MUC1, MUC2, MUC5AC, and MUC6) in ovarian mucinous tumours: changes in expression from benign to malignant tumours.
25124036 2014 Human trefoil factor 2 is a lectin that binds ?-GlcNAc-capped mucin glycans with antibiotic activity against Helicobacter pylori.
24901817 2014 Gastric mucin expression in first-degree relatives of gastric cancer patients.
24840470 2014 Comprehensive glycomics comparison between colon cancer cell cultures and tumours: implications for biomarker studies.
24603585 2014 Prognostic significance of CDX2 and mucin expression in small intestinal adenocarcinoma.
23828549 2014 Mucin phenotype expression of gastric neuroendocrine neoplasms: analysis of histopathology and carcinogenesis.
23807779 2013 Expression of MUC2, MUC5AC, MUC5B, and MUC6 mucins in colorectal cancers and their association with the CpG island methylator phenotype.
23446997 2013 Aberrant expression of mucin core proteins and o-linked glycans associated with progression of pancreatic cancer.
23305535 Secretory carcinoma of breast: pattern of MUC 2/MUC 4/MUC 6 expression.
23163606 2013 Overexpression of enhancer of zeste homolog 2 and MUC1 may be related to malignant behaviour in intraductal papillary neoplasm of the bile duct.
More...