Property Summary

NCBI Gene PubMed Count 40
PubMed Score 104.16
PubTator Score 110.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia -1.200 2.2e-02

Gene RIF (33)

AA Sequence

MAAEASESGPALHELMREAEISLLECKVCFEKFGHRQQRRPRNLSCGHVVCLACVAALAHPRTLALECPF      1 - 70
CRRACRGCDTSDCLPVLHLIELLGSALRQSPAAHRAAPSAPGALTCHHTFGGWGTLVNPTGLALCPKTGR     71 - 140
VVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYPVDVTITNDCHVVVTDAGDRSIKVFDFFGQIKLV    141 - 210
IGGQFSLPWGVETTPQNGIVVTDAEAGSLHLLDVDFAEGVLRRTERLQAHLCNPRGVAVSWLTGAIAVLE    211 - 280
HPLALGTGVCSTRVKVFSSSMQLVGQVDTFGLSLYFPSKITASAVTFDHQGNVIVADTSGPAILCLGKPE    281 - 350
EFPVPKPMVTHGLSHPVALTFTKENSLLVLDTASHSIKVYKVDWG                             351 - 395
//

Text Mined References (41)

PMID Year Title