Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.15
PubTator Score 0.02

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6VB84 Q5JTX9 FOXD4-like 3
Symbols FOXD6
FOXD4L2

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

AA Sequence

MNLPRAERLRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEAASQQFLEQSLQPGLQVARWGGVALP      1 - 70
REHIEGGGGPSDPSEFGTKFRAPPRSAAASEDARQPAKPPYSYIALITMAILQNPHKRLTLSGICAFISG     71 - 140
RFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHQLT    141 - 210
PGAHLPHPFPLPAAHAALHNPRPGPLLGAPAPPQPVPGAYPNTAPGRRPYALLHPHPLRYLLLSAPVYAG    211 - 280
APKKAEGAALATPAPFPCCSPHLVLSLGRRARVWRRHREADASLSALRVLCKGSGERVQGLRRICPRPRG    281 - 350
ATATCSSDHQACCIPRPLPLCCKCPPPPLLGQFCSNSSSIRRRTAPTAALPPRARCWAGTCRPRRPC       351 - 417
//

Text Mined References (5)

PMID Year Title