Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.48
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Glioma 66
Disease Target Count P-value
psoriasis 6685 1.55918715786599E-16
non-small cell lung carcinoma 413 5.27608041386171E-7
lung adenocarcinoma 2714 2.31515681689652E-6
ulcerative colitis 2087 1.38655119128305E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 5.95994656695816E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00347226033830109
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00450913650791632
pancreatic cancer 2300 0.00756359993605029
non primary Sjogren syndrome sicca 840 0.0197308883008745
ductal carcinoma in situ 1745 0.0456369876295012
colon cancer 1475 0.0460101085941248
Disease Target Count Z-score Confidence
Brain cancer 24 0.0 1.0
Disease Target Count Z-score Confidence
Eosinophilic esophagitis 31 3.839 1.9

Expression

AA Sequence

MSQTRKKTSSEGETKPQTSTVNKFLRGSNAESRKEDNDLKTSDSQPSDWIQKTATSETAKPLSSEMEWRS      1 - 70
SMEKNEHFLQKLGKKAVNKCLDLNNCGLTTADMKEMVALLPFLPDLEELDISWNGFVGGTLLSITQQMHL     71 - 140
VSKLKILRLGSCRLTTDDVQALGEAFEMIPELEELNLSWNSKVGGNLPLILQKFQKGSKIQMIELVDCSL    141 - 210
TSEDGTFLGQLLPMLQSLEVLDLSINRDIVGSLNSIAQGLKSTSNLKVLKLHSCGLSQKSVKILDAAFRY    211 - 280
LGELRKLDLSCNKDLGGGFEDSPAQLVMLKHLQVLDLHQCSLTADDVMSLTQVIPLLSNLQELDLSANKK    281 - 350
MGSSSENLLSRLRFLPALKSLVINNCALESETFTALAEASVHLSALEVFNLSWNKCVGGNLKLLLETLKL    351 - 420
SMSLQVLRLSSCSLVTEDVALLASVIQTGHLAKLQKLDLSYNDSICDAGWTMFCQNVRFLKELIELDISL    421 - 490
RPSNFRDCGQWFRHLLYAVTKLPQITEIGMKRWILPASQEEELECFDQDKKRSIHFDHGGFQ            491 - 552
//

Text Mined References (7)

PMID Year Title
24908248 2014 Variants near TERT and TERC influencing telomere length are associated with high-grade glioma risk.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.