Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.13
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Pseudomyxoma peritonei 6 3.835 1.9

Expression

Gene RIF (1)

AA Sequence

MAWKSSVIMQMGRFLLLVILFLPREMTSSVLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYRE      1 - 70
EGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVK     71 - 140
LVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHL    141 - 210
IVKDKTVGVPIEPIIAACVVIFLTLCFGLIARRKKIMKLCMKDKDPHSETAL                      211 - 262
//

Text Mined References (4)

PMID Year Title