Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.43
PubTator Score 0.37

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
19834535 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSQAWVPGLAPTLLFSLLAGPQKIAAKCGLILACPKGFKCCGDSCCQENELFPGPVRIFVIIFLVILSVF      1 - 70
CICGLAKCFCRNCREPEPDSPVDCRGPLELPSIIPPERVRVSLSAPPPPYSEVILKPSLGPTPTEPPPPY     71 - 140
SFRPEEYTGDQRGIDNPAF                                                       141 - 159
//

Text Mined References (7)

PMID Year Title
22120523 2012 Unexpected diversity in Shisa-like proteins suggests the importance of their roles as transmembrane adaptors.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.