Knowledge Summary

Patent

No data available

AA Sequence

MAALSRALGPLRTPAPPLWIGLFLVATGSQQSLAQPLPGNTTEATPRSLRASGSLCGPHAKAPYLCEATH      1 - 70
EPAAARIRAQVPDTRWSRVGGQRFYSRVLSPLHRGPSGHTEASAQRSHMGKLKEPQPQDHKPGLGAS        71 - 137
//

Text Mined References (1)

PMID Year Title