Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6UXP9
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MIFMQILEPQEVPSFLMICQRRSPAMHRTCTDHAPLAIAQVWLWVSLAKAGSNRRGPGRAEGTFFSLLAA      1 - 70
LHAAQHFPNLPTAPGGASQSNIVSPELTPKPTTALKHAECLLDLNSHSLYRKPRPKAAVYLNLSLPLKSV     71 - 140
HRLSLKKSFGFGKRDFENNSVFIVDSGGTCAGLLPGYIGWC                                 141 - 181
//

Text Mined References (1)

PMID Year Title
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.