Property Summary

NCBI Gene PubMed Count 5
PubMed Score 43.13
PubTator Score 33.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.25247379521816E-30
posterior fossa group B ependymoma 1530 3.7098488969446E-6
glioblastoma 5572 1.82433226442707E-4
pilocytic astrocytoma 3086 0.00131916824931824
group 3 medulloblastoma 2254 0.00336306564891506
atypical teratoid / rhabdoid tumor 4369 0.00581591760142887
adult high grade glioma 2148 0.0145831287178295

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 0.006
glioblastoma -1.500 0.000
adult high grade glioma -1.100 0.015
group 3 medulloblastoma 3.100 0.003
pilocytic astrocytoma -1.100 0.001
posterior fossa group B ependymoma -1.200 0.000
psoriasis -1.400 0.000

Synonym

Accession Q6UXK2 A8K352 Q9P263
Symbols LINX

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG Inparanoid
Platypus OMA Inparanoid
Chicken EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

AA Sequence

MFPLRALWLVWALLGVAGSCPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKITVLRRGA      1 - 70
FADVTQVTSLWLAHNEVRTVEPGALAVLSQLKNLDLSHNFISSFPWSDLRNLSALQLLKMNHNRLGSLPR     71 - 140
DALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYHNPFHCGCGLVWLQAWAASTRVSLPEPDSIA    141 - 210
CASPPALQGVPVYRLPALPCAPPSVHLSAEPPLEAPGTPLRAGLAFVLHCIADGHPTPRLQWQLQIPGGT    211 - 280
VVLEPPVLSGEDDGVGAEEGEGEGDGDLLTQTQAQTPTPAPAWPAPPATPRFLALANGSLLVPLLSAKEA    281 - 350
GVYTCRAHNELGANSTSIRVAVAATGPPKHAPGAGGEPDGQAPTSERKSTAKGRGNSVLPSKPEGKIKGQ    351 - 420
GLAKVSILGETETEPEEDTSEGEEAEDQILADPAEEQRCGNGDPSRYVSNHAFNQSAELKPHVFELGVIA    421 - 490
LDVAEREARVQLTPLAARWGPGPGGAGGAPRPGRRPLRLLYLCPAGGGAAVQWSRVEEGVNAYWFRGLRP    491 - 560
GTNYSVCLALAGEACHVQVVFSTKKELPSLLVIVAVSVFLLVLATVPLLGAACCHLLAKHPGKPYRLILR    561 - 630
PQAPDPMEKRIAADFDPRASYLESEKSYPAGGEAGGEEPEDVQGEGLDEDAEQGDPSGDLQREESLAACS    631 - 700
LVESQSKANQEEFEAGSEYSDRLPLGAEAVNIAQEINGNYRQTAG                             701 - 745
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.