Property Summary

NCBI Gene PubMed Count 5
PubMed Score 48.98
PubTator Score 33.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 1.5e-02
Astrocytoma, Pilocytic -1.100 1.7e-03
atypical teratoid / rhabdoid tumor -1.300 5.8e-03
glioblastoma -1.500 1.8e-04
group 3 medulloblastoma 3.100 3.4e-03
posterior fossa group A ependymoma -1.100 6.0e-07
psoriasis -1.400 2.3e-30

AA Sequence

MFPLRALWLVWALLGVAGSCPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKITVLRRGA      1 - 70
FADVTQVTSLWLAHNEVRTVEPGALAVLSQLKNLDLSHNFISSFPWSDLRNLSALQLLKMNHNRLGSLPR     71 - 140
DALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYHNPFHCGCGLVWLQAWAASTRVSLPEPDSIA    141 - 210
CASPPALQGVPVYRLPALPCAPPSVHLSAEPPLEAPGTPLRAGLAFVLHCIADGHPTPRLQWQLQIPGGT    211 - 280
VVLEPPVLSGEDDGVGAEEGEGEGDGDLLTQTQAQTPTPAPAWPAPPATPRFLALANGSLLVPLLSAKEA    281 - 350
GVYTCRAHNELGANSTSIRVAVAATGPPKHAPGAGGEPDGQAPTSERKSTAKGRGNSVLPSKPEGKIKGQ    351 - 420
GLAKVSILGETETEPEEDTSEGEEAEDQILADPAEEQRCGNGDPSRYVSNHAFNQSAELKPHVFELGVIA    421 - 490
LDVAEREARVQLTPLAARWGPGPGGAGGAPRPGRRPLRLLYLCPAGGGAAVQWSRVEEGVNAYWFRGLRP    491 - 560
GTNYSVCLALAGEACHVQVVFSTKKELPSLLVIVAVSVFLLVLATVPLLGAACCHLLAKHPGKPYRLILR    561 - 630
PQAPDPMEKRIAADFDPRASYLESEKSYPAGGEAGGEEPEDVQGEGLDEDAEQGDPSGDLQREESLAACS    631 - 700
LVESQSKANQEEFEAGSEYSDRLPLGAEAVNIAQEINGNYRQTAG                             701 - 745
//

Text Mined References (6)

PMID Year Title