Property Summary

NCBI Gene PubMed Count 18
PubMed Score 14.00
PubTator Score 7.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.300 2.6e-04
astrocytoma -1.400 2.2e-10
Astrocytoma, Pilocytic -1.300 1.3e-03
atypical teratoid / rhabdoid tumor -2.200 8.6e-06
ductal carcinoma in situ 1.200 1.2e-02
ependymoma -2.700 1.5e-10
esophageal adenocarcinoma 1.800 1.9e-02
fibroadenoma 1.700 1.7e-02
glioblastoma -1.600 5.9e-05
group 4 medulloblastoma 1.400 2.9e-03
invasive ductal carcinoma 1.600 2.6e-02
lung adenocarcinoma 1.800 1.6e-07
lung carcinoma 2.900 6.7e-50
malignant mesothelioma -2.100 1.4e-06
non-small cell lung cancer 1.011 2.7e-08
osteosarcoma 1.216 7.2e-03
Pick disease -1.400 2.3e-02
subependymal giant cell astrocytoma -2.562 4.0e-02

Gene RIF (5)

AA Sequence

MGTPRAQHPPPPQLLFLILLSCPWIQGLPLKEEEILPEPGSETPTVASEALAELLHGALLRRGPEMGYLP      1 - 70
GSDRDPTLATPPAGQTLAVPSLPRATEPGTGPLTTAVTPNGVRGAGPTAPELLTPPPGTTAPPPPSPASP     71 - 140
GPPLGPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEGEGYVESPDLGSPVSRTLGLLDCTYSIHVYP    141 - 210
GYGIEIQVQTLNLSQEEELLVLAGGGSPGLAPRLLANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGGGFR    211 - 280
IHYQAYLLSCGFPPRPAHGDVSVTDLHPGGTATFHCDSGYQLQGEETLICLNGTRPSWNGETPSCMASCG    281 - 350
GTIHNATLGRIVSPEPGGAVGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDS    351 - 420
DMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFS    421 - 490
CLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLSPDWPQSYSPGQDCVWGVHVQ    491 - 560
EEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQPRRRLLSSGPDLTLQFQAPPGPPNPGLGQG    561 - 630
FVLHFKEVPRNDTCPELPPPEWGWRTASHGDLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQ    631 - 700
KIMTCADPGEIANGHRTASDAGFPVGSHVQYRCLPGYSLEGAAMLTCYSRDTGTPKWSDRVPKCALKYEP    701 - 770
CLNPGVPENGYQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVTQTTDPSRQL    771 - 840
EGGNLALAILLPLGLVIVLGSGVYIYYTKLQGKSLFGFSGSHSYSPITVESDFSNPLYEAGDTREYEVSI    841 - 910
//

Text Mined References (21)

PMID Year Title