Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.03
PubTator Score 3.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 8.03067312439944E-42
ovarian cancer 8492 7.04566912640972E-11
posterior fossa group A ependymoma 1511 2.30668992184958E-9
malignant mesothelioma 3163 1.39616077618352E-8
Breast cancer 3099 4.57820917293252E-7
pilocytic astrocytoma 3086 6.00302831809466E-6
lung cancer 4473 8.59936628507241E-6
tuberculosis 1563 3.59443026946908E-5
Pick disease 1893 1.42014767474821E-4
cystic fibrosis 1670 3.58912259437902E-4
invasive ductal carcinoma 2950 0.0013266530388135
acute myeloid leukemia 785 0.00246105833926604
pancreatic cancer 2300 0.00301053331574671
primary pancreatic ductal adenocarcinoma 1271 0.00304854562398173
Atopic dermatitis 944 0.00378488968710884
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00646663908707742
subependymal giant cell astrocytoma 2287 0.00702279895562658
atypical teratoid / rhabdoid tumor 4369 0.010296172045566
oligodendroglioma 2849 0.0137221326361076
sonic hedgehog group medulloblastoma 1482 0.0165691788091458
Rheumatoid Arthritis 1171 0.0168681139367526
gastric carcinoma 832 0.0173941887542319
osteosarcoma 7933 0.0180852560164334
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.020383206367136
Hydrolethalus syndrome 128 0.0290863858393852
astrocytoma 1493 0.0337583169078904
Disease Target Count Z-score Confidence
Retinal disease 16 0.0 2.0
Disease Target Count Z-score Confidence
Vulva squamous cell carcinoma 3 3.285 1.6
Sotos syndrome 15 3.097 1.5

Expression

Synonym

Accession Q6UX71 Q96E59 Q96PD9 Q96SU9
Symbols TEM7R

Gene

  Ortholog (13)

Pathway (1)

Gene RIF (5)

PMID Text
25535841 PLXDC1 and PLXDC2 as the transmembrane receptors for the multifunctional factor PEDF.
21310492 We identified a genetic association for susceptibility to retinopathy in 5 novel chromosomal regions and PLXDC2 and ARHGAP22, the latter 2 of which are genes implicated in endothelial cell angiogenesis and increased capillary permeability.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19625618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARFPKADLAAAGVMLLCHFFTDQFQFADGKPGDQILDWQYGVTQAFPHTEEEVEVDSHAYSHRWKRNLD      1 - 70
FLKAVDTNRASVGQDSPEPRSFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPSDSASRDLWVNIDQMEK     71 - 140
DKVKIHGILSNTHRQAARVNLSFDFPFYGHFLREITVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSV    141 - 210
SRNSTVRYFDNGTALVVQWDHVHLQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGL    211 - 280
SDAFVVVHRIQQIPNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNRCGPCVSSQIGFNCSWCS    281 - 350
KLQRCSSGFDRHRQDWVDSGCPEESKEKMCENTEPVETSSRTTTTVGATTTQFRVLTTTRRAVTSQFPTS    351 - 420
LPTEDDTKIALHLKDNGASTDDSAAEKKGGTLHAGLIIGILILVLIVATAILVTVYMYHHPTSAASIFFI    421 - 490
ERRPSRWPAMKFRRGSGHPAYAEVEPVGEKEGFIVSEQC                                   491 - 529
//

Text Mined References (20)

PMID Year Title
25535841 2014 Identification of PLXDC1 and PLXDC2 as the transmembrane receptors for the multifunctional factor PEDF.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21310492 2011 Genome-wide association study of diabetic retinopathy in a Taiwanese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19625618 2009 Three susceptible loci associated with primary open-angle glaucoma identified by genome-wide association study in a Japanese population.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
More...