Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
R01 Count 5
Funding $495,466.99
PubMed Score 6.03
PubTator Score 3.90

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
25535841 PLXDC1 and PLXDC2 as the transmembrane receptors for the multifunctional factor PEDF.
21310492 We identified a genetic association for susceptibility to retinopathy in 5 novel chromosomal regions and PLXDC2 and ARHGAP22, the latter 2 of which are genes implicated in endothelial cell angiogenesis and increased capillary permeability.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19625618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARFPKADLAAAGVMLLCHFFTDQFQFADGKPGDQILDWQYGVTQAFPHTEEEVEVDSHAYSHRWKRNLD      1 - 70
FLKAVDTNRASVGQDSPEPRSFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPSDSASRDLWVNIDQMEK     71 - 140
DKVKIHGILSNTHRQAARVNLSFDFPFYGHFLREITVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSV    141 - 210
SRNSTVRYFDNGTALVVQWDHVHLQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGL    211 - 280
SDAFVVVHRIQQIPNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNRCGPCVSSQIGFNCSWCS    281 - 350
KLQRCSSGFDRHRQDWVDSGCPEESKEKMCENTEPVETSSRTTTTVGATTTQFRVLTTTRRAVTSQFPTS    351 - 420
LPTEDDTKIALHLKDNGASTDDSAAEKKGGTLHAGLIIGILILVLIVATAILVTVYMYHHPTSAASIFFI    421 - 490
ERRPSRWPAMKFRRGSGHPAYAEVEPVGEKEGFIVSEQC                                   491 - 529
//

Text Mined References (20)

PMID Year Title
25535841 2014 Identification of PLXDC1 and PLXDC2 as the transmembrane receptors for the multifunctional factor PEDF.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21310492 2011 Genome-wide association study of diabetic retinopathy in a Taiwanese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19625618 2009 Three susceptible loci associated with primary open-angle glaucoma identified by genome-wide association study in a Japanese population.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
More...