Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.14
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.800 1.6e-03
atypical teratoid / rhabdoid tumor 1.400 8.7e-03
colon cancer -2.800 6.5e-07
glioblastoma 1.200 1.8e-03
intraductal papillary-mucinous carcinoma... 1.300 3.3e-02
intraductal papillary-mucinous neoplasm ... 1.500 5.7e-03
lung adenocarcinoma -1.300 6.5e-13
lung cancer -1.100 4.6e-03
medulloblastoma, large-cell 1.900 4.3e-05
ovarian cancer 1.300 1.8e-06

Gene RIF (1)

AA Sequence

MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEAMEVRFFRGQFSSVVHLYRDG      1 - 70
KDQPFMQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQSYYQKAIWELQVSALGSVPLI     71 - 140
SITGYVDRDIQLLCQSSGWFPRPTAKWKGPQGQDLSTDSRTNRDMHGLFDVEISLTVQENAGSISCSMRH    141 - 210
AHLSREVESRVQIGDTFFEPISWHLATKVLGILCCGLFFGIVGLKIFFSKFQWKIQAELDWRRKHGQAEL    211 - 280
RDARKHAVEVTLDPETAHPKLCVSDLKTVTHRKAPQEVPHSEKRFTRKSVVASQSFQAGKHYWEVDGGHN    281 - 350
KRWRVGVCRDDVDRRKEYVTLSPDHGYWVLRLNGEHLYFTLNPRFISVFPRTPPTKIGVFLDYECGTISF    351 - 420
FNINDQSLIYTLTCRFEGLLRPYIEYPSYNEQNGTPIVICPVTQESEKEASWQRASAIPETSNSESSSQA    421 - 490
TTPFLPRGEM                                                                491 - 500
//

Text Mined References (10)

PMID Year Title