Property Summary

NCBI Gene PubMed Count 10
Grant Count 64
R01 Count 42
Funding $10,471,426.15
PubMed Score 292.32
PubTator Score 303.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... -1.051 0.013

Synonym

Accession Q6UWY2 B2RNW8
Symbols NSP4
PRSSL1
UNQ782

Gene

PDB

4Q7X   4Q7Y   4Q7Z   4Q80  

 GO Process (1)

Gene RIF (2)

PMID Text
25156428 Structural insights in to substrate recognition by the trypsin-fold protease NSP4.
23904161 cathepsin C was identified as the activator of NSP4 in vivo, as cathepsin C deficiency resulted in a complete absence of NSP4 in a Papillon-Lefevre patient

AA Sequence

MGLGLRGWGRPLLTVATALMLPVKPPAGSWGAQIIGGHEVTPHSRPYMASVRFGGQHHCGGFLLRARWVV      1 - 70
SAAHCFSHRDLRTGLVVLGAHVLSTAEPTQQVFGIDALTTHPDYHPMTHANDICLLRLNGSAVLGPAVGL     71 - 140
LRPPGRRARPPTAGTRCRVAGWGFVSDFEELPPGLMEAKVRVLDPDVCNSSWKGHLTLTMLCTRSGDSHR    141 - 210
RGFCSADSGGPLVCRNRAHGLVSFSGLWCGDPKTPDVYTQVSAFVAWIWDVVRRSSPQPGPLPGTTRPPG    211 - 280
EAA                                                                       281 - 283
//

Text Mined References (12)

PMID Year Title
26955973 2016 PEGylated substrates of NSP4 protease: A tool to study protease specificity.
26172376 2015 Design of a Selective Substrate and Activity Based Probe for Human Neutrophil Serine Protease 4.
25156428 2014 Structures of neutrophil serine protease 4 reveal an unusual mechanism of substrate recognition by a trypsin-fold protease.
23904161 2013 NSP4 is stored in azurophil granules and released by activated neutrophils as active endoprotease with restricted specificity.
22474388 2012 NSP4, an elastase-related protease in human neutrophils with arginine specificity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...