Property Summary

NCBI Gene PubMed Count 10
PubMed Score 300.23
PubTator Score 303.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... -1.051 1.3e-02

 GO Process (1)

Gene RIF (2)

AA Sequence

MGLGLRGWGRPLLTVATALMLPVKPPAGSWGAQIIGGHEVTPHSRPYMASVRFGGQHHCGGFLLRARWVV      1 - 70
SAAHCFSHRDLRTGLVVLGAHVLSTAEPTQQVFGIDALTTHPDYHPMTHANDICLLRLNGSAVLGPAVGL     71 - 140
LRPPGRRARPPTAGTRCRVAGWGFVSDFEELPPGLMEAKVRVLDPDVCNSSWKGHLTLTMLCTRSGDSHR    141 - 210
RGFCSADSGGPLVCRNRAHGLVSFSGLWCGDPKTPDVYTQVSAFVAWIWDVVRRSSPQPGPLPGTTRPPG    211 - 280
EAA                                                                       281 - 283
//

Text Mined References (12)

PMID Year Title