Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.99
PubTator Score 2.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Signet ring cell adenocarcinoma 2 4.423 2.2

Gene RIF (1)

AA Sequence

MSRSRLFSVTSAISTIGILCLPLFQLVLSDLPCEEDEMCVNYNDQHPNGWYIWILLLLVLVAALLCGAVV      1 - 70
LCLQCWLRRPRIDSHRRTMAVFAVGDLDSIYGTEAAVSPTVGIHLQTQTPDLYPVPAPCFGPLGSPPPYE     71 - 140
EIVKTT                                                                    141 - 146
//

Text Mined References (5)

PMID Year Title