Property Summary

NCBI Gene PubMed Count 20
PubMed Score 65.02
PubTator Score 12.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma 1.136 0.019
ependymoma -1.600 0.000
glioblastoma -2.200 0.000
sonic hedgehog group medulloblastoma -2.600 0.000
atypical teratoid/rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -3.500 0.000
primitive neuroectodermal tumor -1.800 0.004
adult high grade glioma -2.300 0.000
pilocytic astrocytoma -1.400 0.000
subependymal giant cell astrocytoma -1.065 0.016
psoriasis -2.100 0.000

Gene RIF (20)

PMID Text
26435060 Lipids originating either from the diet or from endogenous production appear to positively affect plasma adropin concentrations in humans.
26371163 Serum adropin level was negatively correlated with carotid beta-stiffness and positively correlated with plasma NOx level and cardiorespiratory fitness
26226125 The adropin levels of metabolic syndrome, obesity, and control groups also showed no difference
26172926 Circulating adropin levels were determined lower in patients with endometrial cancer than in a control group.
26030787 Serum adropin levels were significantly lower in obese children; however, there was no correlation between serum adropin levels and blood pressure variables.
25913544 Adropin as a novel energy factor likely has the ability to regulate blood pressure
25282140 Adropin levels are lower in patients with late saphenous vein graft occlusion and these reduced adropin levels, together with other factors, may lead to saphenous vein graft occlusion
24848071 Release of adropin in the fed condition regulates fuel selection in skeletal muscle, promoting glucose oxidation over fat oxidation. The molecular mechanisms of adropin's effects involve acetylation (suggesting inhibition) of the transcriptional co-activator PGC1alpha, reducing PDK4 and CPT1B activity. Increased PGC1alpha acetylation by adropin may be mediated by inhibiting Sirtuin-1 (SIRT1), a PGC1alpha deacetylase.
24731968 decreased serum adropin levels are associated with the presence of acute myocardial infarction in coronary artery disease patients
24468600 Assessment of serum adropin concentrations may provide a reliable indicator of fatty liver disease in obese adolescents
More...

AA Sequence

MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEG      1 - 70
SYLLQP                                                                     71 - 76
//

Text Mined References (21)

PMID Year Title
26435060 2015 Differential Responses of Plasma Adropin Concentrations To Dietary Glucose or Fructose Consumption In Humans.
26371163 2015 Aerobic exercise training-induced changes in serum adropin level are associated with reduced arterial stiffness in middle-aged and older adults.
26226125 2015 Are obesity and metabolic syndrome associated with plasma adropin levels in children?
26172926 2015 Circulating adropin levels in patients with endometrium cancer.
26030787 2015 Evaluation of the relationship between serum adropin levels and blood pressure in obese children.
25913544 2015 Adropin as a novel energy factor likely has the ability to regulate blood pressure.
25282140 2014 Adropin: a new marker for predicting late saphenous vein graft disease after coronary artery bypass grafting.
24848071 2014 Regulation of substrate oxidation preferences in muscle by the peptide hormone adropin.
24731968 2014 Serum adropin levels are decreased in patients with acute myocardial infarction.
24468600 2014 Investigation of adropin and leptin levels in pediatric obesity-related nonalcoholic fatty liver disease.
More...