Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.50
PubTator Score 32.39

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 0.000

Gene RIF (5)

PMID Text
26828269 KLKs. Thereby, beside the conserved binding mode, we identified an alternate binding mode which has so far not been observed for SPINK inhibitors.
24352040 Our study indicates that Spink6 is a potent inhibitor of kallikrein related peptidases and involved in skin barrier function.
23303447 Cross-linked SPINK6 might protect specific substrates such as fibronectin from kallikrein-related peptidases cleavage and contribute to the regulation of proteases in the epidermis.
21439340 Serine protease of Kazal-type (SPINK6) expressed in normal human skin is a potent natural inhibitor of Kallikrein-related peptidases, KLK12 and KLK13.
20667819 Data suggest that SPINK6 plays a role in modulating the activity of kallikreins in human skin.

AA Sequence

MKLSGMFLLLSLALFCFLTGVFSQGGQVDCGEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGG      1 - 70
KISLKHPGKC                                                                 71 - 80
//

Text Mined References (11)

PMID Year Title
26828269 2016 The solution structure of the kallikrein-related peptidases inhibitor SPINK6.
24352040 2014 Characterization of Spink6 in mouse skin: the conserved inhibitor of kallikrein-related peptidases is reduced by barrier injury.
23303447 2013 Cross-linking of SPINK6 by transglutaminases protects from epidermal proteases.
21439340 2011 Inhibition of kallikrein-related peptidases by the serine protease inhibitor of Kazal-type 6.
20667819 2010 Isolation of SPINK6 in human skin: selective inhibitor of kallikrein-related peptidases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15060002 2004 A genomic analysis of rat proteases and protease inhibitors.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...