Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.76
PubTator Score 32.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.8e-05

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 1.8e-05

Gene RIF (7)

AA Sequence

MKLSGMFLLLSLALFCFLTGVFSQGGQVDCGEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGG      1 - 70
KISLKHPGKC                                                                 71 - 80
//

Text Mined References (13)

PMID Year Title