Property Summary

NCBI Gene PubMed Count 6
PubMed Score 34.98
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Pilocytic astrocytoma 56 1.3e-04
non primary Sjogren syndrome sicca 891 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Osteoarthritis 184 4.295 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.100 1.9e-02
Pilocytic astrocytoma 1.100 1.3e-04

Gene RIF (1)

AA Sequence

MKPVWVATLLWMLLLVPRLGAARKGSPEEASFYYGTFPLGFSWGVGSSAYQTEGAWDQDGKGPSIWDVFT      1 - 70
HSGKGKVLGNETADVACDGYYKVQEDIILLRELHVNHYRFSLSWPRLLPTGIRAEQVNKKGIEFYSDLID     71 - 140
ALLSSNITPIVTLHHWDLPQLLQVKYGGWQNVSMANYFRDYANLCFEAFGDRVKHWITFSDPRAMAEKGY    141 - 210
ETGHHAPGLKLRGTGLYKAAHHIIKAHAKAWHSYNTTWRSKQQGLVGISLNCDWGEPVDISNPKDLEAAE    211 - 280
RYLQFCLGWFANPIYAGDYPQVMKDYIGRKSAEQGLEMSRLPVFSLQEKSYIKGTSDFLGLGHFTTRYIT    281 - 350
ERNYPSRQGPSYQNDRDLIELVDPNWPDLGSKWLYSVPWGFRRLLNFAQTQYGDPPIYVMENGASQKFHC    351 - 420
TQLCDEWRIQYLKGYINEMLKAIKDGANIKGYTSWSLLDKFEWEKGYSDRYGFYYVEFNDRNKPRYPKAS    421 - 490
VQYYKKIIIANGFPNPREVESWYLKALETCSINNQMLAAEPLLSHMQMVTEIVVPTVCSLCVLITAVLLM    491 - 560
LLLRRQS                                                                   561 - 567
//

Text Mined References (7)

PMID Year Title