Property Summary

NCBI Gene PubMed Count 6
Grant Count 2
Funding $251,495.45
PubMed Score 31.17
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pilocytic astrocytoma 1.100 0.000
non primary Sjogren syndrome sicca -1.100 0.019

Synonym

Accession Q6UWM7 B3KQY0
Symbols KLG
KLPH

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (1)

PMID Text
12084582 The authors identified and cloned the mouse lactase-like gene (also known as Lctl, Klph). It is a member of the family 1 glycosidases but lacks one of the conserved glutamic acid residues important for catalysis. Its function remains to be determined.

AA Sequence

MKPVWVATLLWMLLLVPRLGAARKGSPEEASFYYGTFPLGFSWGVGSSAYQTEGAWDQDGKGPSIWDVFT      1 - 70
HSGKGKVLGNETADVACDGYYKVQEDIILLRELHVNHYRFSLSWPRLLPTGIRAEQVNKKGIEFYSDLID     71 - 140
ALLSSNITPIVTLHHWDLPQLLQVKYGGWQNVSMANYFRDYANLCFEAFGDRVKHWITFSDPRAMAEKGY    141 - 210
ETGHHAPGLKLRGTGLYKAAHHIIKAHAKAWHSYNTTWRSKQQGLVGISLNCDWGEPVDISNPKDLEAAE    211 - 280
RYLQFCLGWFANPIYAGDYPQVMKDYIGRKSAEQGLEMSRLPVFSLQEKSYIKGTSDFLGLGHFTTRYIT    281 - 350
ERNYPSRQGPSYQNDRDLIELVDPNWPDLGSKWLYSVPWGFRRLLNFAQTQYGDPPIYVMENGASQKFHC    351 - 420
TQLCDEWRIQYLKGYINEMLKAIKDGANIKGYTSWSLLDKFEWEKGYSDRYGFYYVEFNDRNKPRYPKAS    421 - 490
VQYYKKIIIANGFPNPREVESWYLKALETCSINNQMLAAEPLLSHMQMVTEIVVPTVCSLCVLITAVLLM    491 - 560
LLLRRQS                                                                   561 - 567
//

Text Mined References (7)

PMID Year Title
22020932 2011 Short hairpin RNA screen indicates that Klotho beta/FGF19 protein overcomes stasis in human colonic epithelial cells.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12084582 2002 Identification of a novel mouse membrane-bound family 1 glycosidase-like protein, which carries an atypical active site structure.
9779294 1998 Sequence, structural, functional, and phylogenetic analyses of three glycosidase families.