Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.36
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.6e-33

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 2.6e-33

Gene RIF (1)

AA Sequence

MEAPGPRALRTALCGGCCCLLLCAQLAVAGKGARGFGRGALIRLNIWPAVQGACKQLEVCEHCVEGDRAR      1 - 70
NLSSCMWEQCRPEEPGHCVAQSEVVKEGCSIYNRSEACPAAHHHPTYEPKTVTTGSPPVPEAHSPGFDGA     71 - 140
SFIGGVVLVLSLQAVAFFVLHFLKAKDSTYQTLI                                        141 - 174
//

Text Mined References (7)

PMID Year Title