Property Summary

NCBI Gene PubMed Count 19
Grant Count 4
Funding $890,198.5
PubMed Score 10.92
PubTator Score 6.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -2.500 0.009
ependymoma -1.800 0.042
oligodendroglioma -2.100 0.040
glioblastoma -3.000 0.000
medulloblastoma -2.700 0.004
periodontitis 1.100 0.000
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -3.600 0.001
primitive neuroectodermal tumor -3.500 0.000
adrenocortical adenoma -1.050 0.014
adrenocortical carcinoma -1.827 0.009
non-small cell lung cancer -1.983 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.037
lung cancer -2.900 0.000
breast carcinoma -1.300 0.000
diabetes mellitus -1.100 0.008
adult high grade glioma -2.200 0.014
pilocytic astrocytoma -1.800 0.006
lung adenocarcinoma -1.300 0.001
lung carcinoma -1.400 0.000
Pick disease -1.500 0.035
ovarian cancer -1.900 0.000

Synonym

Accession Q6UWI2 B3KMQ9 Q96DV8 Q9Y4S1 PARM-1
Symbols WSC4
Cipar1
PARM-1
DKFZP564O0823

Gene

Gene RIF (4)

PMID Text
23902727 Our results strongly suggest the oncogenic potential of PARM-1.
22766399 PARM1 does not play a major role in the development of epispadias
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18027867 Ectopic expression of hPARM-1 in PC3 prostate cancer cells increased colony formation, suggesting a probable role in cell proliferation.

AA Sequence

MVYKTLFALCILTAGWRVQSLPTSAPLSVSLPTNIVPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTA      1 - 70
SAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGTPEAGVAATLSQ     71 - 140
SAAEPPTLISPQAPASSPSSLSTSPPEVFSASVTTNHSSTVTSTQPTGAPTAPESPTEESSSDHTPTSHA    141 - 210
TAEPVPQEKTPPTTVSGKVMCELIDMETTTTFPRVIMQEVEHALSSGSIAAITVTVIAVVLLVFGVAAYL    211 - 280
KIRHSSYGRLLDDHDYGSWGNYNNPLYDDS                                            281 - 310
//

Text Mined References (20)

PMID Year Title
23902727 2013 Characterization and identification of PARM-1 as a new potential oncogene.
22766399 2012 Murine expression and mutation analyses of the prostate androgen-regulated mucin-like protein 1 (Parm1) gene, a candidate for human epispadias.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18027867 2008 Human PARM-1 is a novel mucin-like, androgen-regulated gene exhibiting proliferative effects in prostate cancer cells.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466293 2004 High-content screening microscopy identifies novel proteins with a putative role in secretory membrane traffic.
More...