Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.10
PubTator Score 6.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical adenoma -1.050 1.4e-02
adrenocortical carcinoma -1.370 1.4e-03
adult high grade glioma -1.300 4.5e-03
astrocytic glioma -2.500 8.9e-03
Astrocytoma, Pilocytic -1.800 5.8e-03
atypical teratoid / rhabdoid tumor -1.300 8.8e-04
breast carcinoma -1.300 3.7e-05
diabetes mellitus -1.100 8.1e-03
ependymoma -1.800 4.2e-02
glioblastoma -1.800 2.3e-03
group 4 medulloblastoma -1.300 5.3e-03
intraductal papillary-mucinous neoplasm ... 1.100 3.7e-02
lung adenocarcinoma -1.300 9.5e-04
lung cancer -2.900 6.1e-06
lung carcinoma -1.400 3.0e-06
medulloblastoma, large-cell -1.600 1.4e-02
non-small cell lung cancer -1.983 2.9e-12
oligodendroglioma -2.100 4.0e-02
ovarian cancer -1.400 7.3e-08
periodontitis 1.100 1.1e-14
Pick disease -1.500 3.5e-02
primitive neuroectodermal tumor -1.600 2.8e-03

Gene RIF (4)

AA Sequence

MVYKTLFALCILTAGWRVQSLPTSAPLSVSLPTNIVPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTA      1 - 70
SAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGTPEAGVAATLSQ     71 - 140
SAAEPPTLISPQAPASSPSSLSTSPPEVFSASVTTNHSSTVTSTQPTGAPTAPESPTEESSSDHTPTSHA    141 - 210
TAEPVPQEKTPPTTVSGKVMCELIDMETTTTFPRVIMQEVEHALSSGSIAAITVTVIAVVLLVFGVAAYL    211 - 280
KIRHSSYGRLLDDHDYGSWGNYNNPLYDDS                                            281 - 310
//

Text Mined References (20)

PMID Year Title