Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.92
PubTator Score 6.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
periodontitis 269 1.12052712122618E-14
non-small cell lung cancer 2798 2.88253323761955E-12
ovarian cancer 8492 1.2519181979135E-11
atypical teratoid / rhabdoid tumor 4369 5.61931376194379E-7
lung carcinoma 2844 2.97500136163509E-6
lung cancer 4473 6.07926354767057E-6
breast carcinoma 1614 3.67647640806934E-5
primitive neuroectodermal tumor 3031 7.2858073342443E-5
glioblastoma 5572 2.28783122113346E-4
lung adenocarcinoma 2714 9.46900933444978E-4
medulloblastoma, large-cell 6234 0.00129149597274989
medulloblastoma 1524 0.00370612335488904
pilocytic astrocytoma 3086 0.00553676918001084
diabetes mellitus 1663 0.0080902126979298
astrocytic glioma 2241 0.0088680975729404
adrenocortical carcinoma 1427 0.00889275241554342
adult high grade glioma 2148 0.0141215002680378
adrenocortical adenoma 134 0.014125531474443
Pick disease 1893 0.0346259308350222
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0370370281334517
oligodendroglioma 2849 0.0401884924643505
ependymoma 2514 0.0419545037994717
Disease Target Count Z-score Confidence
Hypertensive heart disease 3 3.331 1.7
Irritable bowel syndrome 59 3.217 1.6

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -2.500 0.009
ependymoma -1.800 0.042
oligodendroglioma -2.100 0.040
glioblastoma -3.000 0.000
medulloblastoma -2.700 0.004
periodontitis 1.100 0.000
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -3.600 0.001
primitive neuroectodermal tumor -3.500 0.000
adrenocortical adenoma -1.050 0.014
adrenocortical carcinoma -1.827 0.009
non-small cell lung cancer -1.983 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.037
lung cancer -2.900 0.000
breast carcinoma -1.300 0.000
diabetes mellitus -1.100 0.008
adult high grade glioma -2.200 0.014
pilocytic astrocytoma -1.800 0.006
lung adenocarcinoma -1.300 0.001
lung carcinoma -1.400 0.000
Pick disease -1.500 0.035
ovarian cancer -1.900 0.000

Synonym

Accession Q6UWI2 B3KMQ9 Q96DV8 Q9Y4S1 PARM-1
Symbols WSC4
Cipar1
PARM-1
DKFZP564O0823

Gene

  Ortholog (7)

Pathway (1)

Gene RIF (4)

PMID Text
23902727 Our results strongly suggest the oncogenic potential of PARM-1.
22766399 PARM1 does not play a major role in the development of epispadias
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18027867 Ectopic expression of hPARM-1 in PC3 prostate cancer cells increased colony formation, suggesting a probable role in cell proliferation.

AA Sequence

MVYKTLFALCILTAGWRVQSLPTSAPLSVSLPTNIVPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTA      1 - 70
SAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGTPEAGVAATLSQ     71 - 140
SAAEPPTLISPQAPASSPSSLSTSPPEVFSASVTTNHSSTVTSTQPTGAPTAPESPTEESSSDHTPTSHA    141 - 210
TAEPVPQEKTPPTTVSGKVMCELIDMETTTTFPRVIMQEVEHALSSGSIAAITVTVIAVVLLVFGVAAYL    211 - 280
KIRHSSYGRLLDDHDYGSWGNYNNPLYDDS                                            281 - 310
//

Text Mined References (20)

PMID Year Title
23902727 2013 Characterization and identification of PARM-1 as a new potential oncogene.
22766399 2012 Murine expression and mutation analyses of the prostate androgen-regulated mucin-like protein 1 (Parm1) gene, a candidate for human epispadias.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18027867 2008 Human PARM-1 is a novel mucin-like, androgen-regulated gene exhibiting proliferative effects in prostate cancer cells.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466293 2004 High-content screening microscopy identifies novel proteins with a putative role in secretory membrane traffic.
More...