Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.05

Knowledge Summary


No data available


  Disease Relevance (1)

Disease Z-score Confidence
Endometriosis 535


AA Sequence

HGHQKDIWAQSLVSLFQALRHDLMRSSQPGVPP                                         141 - 173

Text Mined References (8)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.