Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Endometriosis 540 0.0 0.0

Expression

AA Sequence

MHWKMLLLLLLYYNAEASMCHRWSRAVLFPAAHRPKRSSSLPLNPVLQTSLEEVELLYEFLLAELEISPD      1 - 70
LQISIKDEELASLRKASDFRTVCNNVIPKSIPDIRRLSASLSSHPGILKKEDFERTVLTLAYTAYRTALS     71 - 140
HGHQKDIWAQSLVSLFQALRHDLMRSSQPGVPP                                         141 - 173
//

Text Mined References (8)

PMID Year Title