Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.7e-03

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 2.7e-03

AA Sequence

MAAALALVAGVLSGAVLPLWSALPQYKKKITDRCFHHSECYSGCCLMDLDSGGAFCAPRARITMICLPQT      1 - 70
KGATNIICPCRMGLTCISKDLMCSRRCHMI                                             71 - 100
//

Text Mined References (3)

PMID Year Title