Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

AA Sequence

MAAALALVAGVLSGAVLPLWSALPQYKKKITDRCFHHSECYSGCCLMDLDSGGAFCAPRARITMICLPQT      1 - 70
KGATNIICPCRMGLTCISKDLMCSRRCHMI                                             71 - 100
//

Text Mined References (3)

PMID Year Title
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.